close all open/close all

CDS information : Aver_00160


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction78,352 / 76,943 / - [in whole cluster]
7,397 / 5,988 / - [in contig]
Locationcomplement(76943..78352) [in whole cluster]
complement(5988..7397) [in contig]
TypeCDS
Length1,410 bp (469 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)dTDP-4-keto-6-deoxy-L-hexose2,3-dehydratase
Gene
Gene (GenBank)aveBVI
EC number
Keyword
  • L-oleandrose
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
Related Reference
ACC
Q845B8
PmId
[12889805] Functional identification of rub52 gene involved in the biosynthesis of rubradirin. (Biotechnol Lett. , 2003)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [dTDP-4-keto-6-deoxy-L-hexose2,3-dehydratase]
MSVRADADHTEPSTAHRAARRRPARVPRPLRRRGRHRRRTSLDAFTGWWTRRSGAHRFRV
ERIPFHGMDAWSFHPGTGNLAHRSGRFFSVEGLHVRGGEQPFPEWQQPIIHQPEIGILGI
LAKKFDGVLHFLMQAKMEPGNINLVQLSPTVQATRSNYTKVHGGAAVKYLEYFTQPRRAT
VVVDVLQSEHGAWFHRKFNRNIVVETDEDVPLDDDFRWLTLGQIGELMHRDNLVNMDART
VLACLPTPFDEPAALHSDAELLSWYAAERSRHSVHARRVPLAGIPGWTTGAESIAHHADR
YFRVVAVRVEASNREVAAWTQPLIEPCGHGITAFLTRRIGGVPHLLAHGRVEGGFLDTIE
LGPTVQYTPRNYAHLTGPARPRFLDLVLEAAPDRIRYAAVHSEEGGRFLHAQARYLFVEA
DESQAPNDPPPGYRWCTPGQLTQLLRYGRYVNVQARTLLSLLTTRAVEL
selected fasta
>putative NDP-hexose 2,3-dehydratase [dTDP-4-keto-6-deoxy-L-hexose2,3-dehydratase]
ATGAGCGTACGAGCCGATGCCGACCACACCGAGCCCAGCACCGCTCACCGCGCGGCACGA
CGCCGCCCTGCCCGCGTGCCTCGCCCGCTCCGCCGCCGTGGGCGACACCGGCGCCGGACG
TCCCTCGACGCGTTCACCGGCTGGTGGACGCGGCGGTCCGGGGCCCACCGGTTCCGGGTC
GAGCGCATCCCCTTCCACGGGATGGACGCCTGGTCGTTTCACCCCGGAACCGGCAATCTG
GCCCACCGCAGCGGCCGGTTCTTCTCCGTGGAGGGACTGCACGTCCGAGGCGGTGAACAG
CCCTTCCCGGAATGGCAGCAGCCCATCATCCACCAGCCCGAGATCGGCATCCTCGGCATC
CTCGCCAAGAAGTTCGACGGGGTCCTGCACTTCCTGATGCAGGCCAAGATGGAGCCCGGC
AACATCAACCTGGTCCAGCTGTCGCCCACCGTGCAGGCCACGCGCAGCAACTACACCAAG
GTCCACGGGGGCGCCGCCGTGAAGTACCTCGAGTACTTCACACAGCCCCGGCGCGCCACC
GTGGTGGTCGACGTCCTCCAGTCCGAGCACGGAGCCTGGTTCCACCGGAAGTTCAACCGC
AACATCGTGGTGGAGACCGACGAGGACGTACCACTGGACGACGACTTCCGCTGGCTGACA
CTGGGGCAGATCGGCGAACTGATGCACCGGGACAACCTGGTGAACATGGACGCACGCACG
GTCCTCGCCTGCCTTCCCACCCCGTTCGACGAGCCCGCGGCCCTGCACAGCGACGCCGAA
CTGCTCTCCTGGTACGCCGCCGAACGCTCCCGGCACTCCGTGCACGCCCGCCGCGTGCCC
CTGGCCGGCATCCCCGGCTGGACCACGGGCGCGGAGTCCATCGCCCACCACGCGGACCGG
TACTTCCGTGTGGTCGCGGTCCGTGTCGAGGCCTCCAACCGGGAGGTCGCCGCCTGGACC
CAGCCCCTGATCGAACCGTGCGGCCACGGCATCACCGCCTTCCTGACCCGGCGGATCGGC
GGCGTACCGCACCTGCTCGCCCACGGCAGGGTCGAGGGCGGCTTCCTCGACACGATCGAA
CTCGGCCCGACGGTCCAGTACACCCCGCGCAACTACGCCCACCTCACGGGACCGGCCAGG
CCGCGCTTCCTCGACCTGGTGCTGGAGGCCGCGCCCGACCGCATCCGCTACGCGGCGGTC
CACTCGGAGGAGGGCGGTCGCTTTCTGCACGCACAGGCGCGCTACCTGTTCGTCGAGGCC
GACGAGAGCCAGGCGCCGAACGACCCGCCCCCGGGGTACCGCTGGTGCACCCCGGGCCAG
CTGACCCAGCTGCTGCGGTACGGCCGTTACGTGAACGTGCAGGCCCGCACCCTGCTGTCC
CTGCTCACCACCCGCGCCGTCGAGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [41-245]  1e-87 PF03559 [256-462]  2.99999999999998e-80 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit