close all open/close all

CDS information : Aver_00170


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction79,122 / 78,349 / - [in whole cluster]
8,167 / 7,394 / - [in contig]
Locationcomplement(78349..79122) [in whole cluster]
complement(7394..8167) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-3 O-methyltransferase
Product (GenBank)dTDP-6-deoxy-L-hexose 3-O-methyltransferase
Gene
Gene (GenBank)aveBVII
EC number2.1.1.-
Keyword
  • L-oleandrose
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>NDP-hexose C-3 O-methyltransferase [dTDP-6-deoxy-L-hexose 3-O-methyltransferase]
MTEREFTDPRIVPHESEQERAAREQLTKLLVDSPIPPKYLIDNLSVYMRRNQLADLLSMD
ALYRMLPEVPGVIMEFGVLHGRHLATLTALRSIYEPYNSLRRVIGFDTFTGFPDIDEADE
VSTSAVPGRFAVPDGEVEHLRQVLAAHEANEPYGHTQRSFVVQGDVRETVPQYLAEHPHT
VIALAYFDLDLYRPTRELLDVITPHLTRGSILAFDELTHPKWPGETRALSEAFGLDHAPL
RQLPGREPPVIYMTWGA
selected fasta
>NDP-hexose C-3 O-methyltransferase [dTDP-6-deoxy-L-hexose 3-O-methyltransferase]
ATGACCGAGCGGGAGTTCACCGATCCCCGGATCGTGCCGCACGAGTCCGAGCAGGAACGC
GCTGCCCGCGAGCAGCTGACCAAGCTCCTCGTCGACAGCCCGATCCCGCCGAAGTACCTG
ATCGACAACCTGTCCGTCTACATGCGGCGCAACCAGCTCGCCGACCTGCTCTCCATGGAC
GCGCTGTACCGCATGCTGCCGGAAGTCCCCGGCGTCATCATGGAGTTCGGCGTTCTGCAC
GGACGGCACCTCGCCACGCTGACCGCGCTGCGCAGCATCTATGAGCCGTACAACTCGCTG
CGCCGCGTCATCGGCTTCGACACGTTCACCGGCTTCCCCGACATCGACGAGGCGGACGAG
GTCAGCACCAGCGCGGTCCCTGGGCGGTTCGCCGTGCCGGACGGCGAAGTGGAGCACCTG
CGGCAGGTGCTCGCGGCGCACGAGGCGAACGAACCCTACGGCCACACCCAGCGTTCCTTC
GTGGTCCAGGGCGACGTACGCGAAACGGTGCCCCAATACCTGGCGGAACACCCGCACACC
GTCATCGCGCTGGCCTACTTCGACCTGGACCTCTACCGCCCCACGCGCGAACTGCTGGAC
GTCATCACACCGCACCTGACCAGGGGCAGCATCCTCGCCTTCGACGAACTCACCCACCCC
AAATGGCCGGGGGAGACCAGGGCGCTGAGCGAGGCGTTCGGCCTCGACCACGCCCCACTG
CGCCAACTGCCCGGCCGCGAGCCACCGGTGATCTACATGACGTGGGGTGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [68-218]  6.3e-05 PF05711
PF05711   TylF
SignalP No significant hit
TMHMM No significant hit