close all open/close all
Aver_00170 Aver_00170   last last

CDS information : Aver_00180


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction80,252 / 79,209 / - [in whole cluster]
9,297 / 8,254 / - [in contig]
Locationcomplement(79209..80252) [in whole cluster]
complement(8254..9297) [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-hexose C-3 ketoreductase
Product (GenBank)dTDP-4-keto-6-deoxy-L-hexose 2,3-reductase
Gene
Gene (GenBank)aveBVIII
EC number
Keyword
  • L-oleandrose
  • axial-OH
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
Related Reference
ACC
Q9XC70
PmId
[16448097] A two-stage one-pot enzymatic synthesis of TDP-L-mycarose from thymidine and glucose-1-phosphate. (J Am Chem Soc. , 2006)
ACC
Q9F833
NITE
Megalo_00090
PmId
[17571859] Characterization of the heterodimeric MegBIIa:MegBIIb aldo-keto reductase involved in the biosynthesis of L-mycarose from Micromonospora megalomicea. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>putative dTDP-hexose C-3 ketoreductase [dTDP-4-keto-6-deoxy-L-hexose 2,3-reductase]
MMPTTAEPAPVQSDSNSSAPLHTELGRTRLRISRLALGTVNIGGRVEEPEARRLMDHALA
QGITLFDTANTYGWRVHKGYTEEVIGRWLADRPARREQVVLATKVGDPMGSGPNDHGLSV
RNIVAACDASLRRLRTDWIDLYQLHHIDRRAGWDEVWQAMDLLITQGKVRYVGSSNFAGW
DIASAQEAARRRNALGLASEQCVYNLVTRHAELEVIPAASAYGVGVLVWSPLHGGLLGGV
LRKTRENTAVKSAQGRAVEALEHHRTTIAAYEDVCADHGLDPAHVGMAWVLSRPGVTGLV
IGPRTEQHVDGALHALRTPLPEPVLARLEELFPPVGRGGSAPDAWLS
selected fasta
>putative dTDP-hexose C-3 ketoreductase [dTDP-4-keto-6-deoxy-L-hexose 2,3-reductase]
ATGATGCCTACGACGGCCGAGCCCGCACCCGTCCAGTCCGACAGCAACAGCAGTGCTCCC
CTCCACACCGAACTGGGCAGGACCCGGCTGAGGATCAGCCGACTGGCGCTCGGAACGGTC
AACATCGGCGGACGGGTGGAGGAGCCCGAAGCGCGCCGACTGATGGATCACGCCCTGGCT
CAGGGCATCACCCTGTTCGACACCGCCAACACCTACGGCTGGCGCGTCCACAAGGGGTAC
ACCGAAGAGGTCATCGGCAGGTGGCTGGCGGACCGCCCCGCCCGGCGTGAGCAGGTGGTG
CTGGCCACCAAGGTCGGCGATCCGATGGGCAGCGGCCCCAACGATCACGGACTGTCCGTA
CGCAATATCGTGGCCGCCTGCGACGCCTCGCTGCGCCGACTGCGCACCGACTGGATCGAC
CTGTACCAGCTGCACCACATCGACCGCCGCGCCGGCTGGGACGAGGTGTGGCAGGCGATG
GACCTGCTCATCACGCAGGGCAAGGTGCGCTACGTCGGCTCCTCCAACTTCGCGGGCTGG
GACATCGCTTCCGCCCAGGAGGCGGCCCGGCGGCGCAACGCCCTGGGCCTCGCCTCCGAG
CAGTGCGTCTACAACCTCGTGACCCGACACGCCGAGCTGGAAGTCATCCCCGCCGCGTCC
GCCTACGGTGTCGGCGTCCTGGTCTGGTCGCCACTGCACGGCGGCCTGCTCGGCGGTGTC
CTGCGCAAGACGCGGGAGAACACCGCGGTCAAGTCGGCACAGGGCCGGGCCGTCGAGGCC
CTGGAGCACCACCGCACCACCATCGCGGCGTACGAGGACGTGTGCGCGGACCACGGCCTC
GACCCCGCCCATGTCGGCATGGCCTGGGTGCTGTCGCGGCCCGGCGTGACCGGGCTGGTC
ATCGGGCCGCGCACCGAACAGCACGTGGACGGGGCACTGCACGCCCTGCGCACCCCGCTG
CCCGAGCCCGTCCTGGCCCGCCTGGAGGAGCTGTTCCCCCCGGTCGGCCGCGGCGGATCC
GCCCCCGACGCCTGGCTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [30-333]  1e-83 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [22-337]  2.0000139277205e-82 SSF51430
SSF51430   Aldo/ket_red
 [34-332]  3.30000000000002e-68 PF00248
PF00248   Aldo_ket_red
SignalP No significant hit
TMHMM No significant hit
Aver_00170 Aver_00170   last last