close all open/close all
first first   Avil_00020 Avil_00020

CDS information : Avil_00010


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction1,590 / 2,678 / + [in whole cluster]
1,590 / 2,678 / + [in contig]
Location1590..2678 [in whole cluster]
1590..2678 [in contig]
TypeCDS
Length1,089 bp (362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative GTP-binding protein
Product (GenBank)putative GTP binding protein
Gene
Gene (GenBank)aviX1
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
  • AviX1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
P44681
PmId
[12837776] Crystal structure of the YchF protein reveals binding sites for GTP and nucleic acid. (J Bacteriol. , 2003)

close this sectionSequence

selected fasta
>putative GTP-binding protein [putative GTP binding protein]
MSLTIGIVGLPNVGKSTLFNALTKNDVLAANYPFATIEPNVGVVGVPDARLTKLAEIFSS
QRILPATVDFVDIAGIVRGASEGEGLGNKFLANIRESDAICQVIRAFKDENVVHVDGKVS
PKDDIETINTELILADLQTIEKVLPRLQKDSRIKKDLAPKVKAVEEAKEILERGDTLFAH
GIVQGTERNELLHDLHLLTTKPFLYVFNVDEDELIDEDFKNEQRALVAPAEAIFLNAKLE
ADLAELDDDEALELLQSVGQDEPGLATLARVGFNTLGLQTYLTAGPKESRAWTIKKGATA
PEAAGVIHTDFQKGFIKAEVISFTDLVETGSVAEARAKGKARMEGKDYVMQDGDVVEFRF
NV
selected fasta
>putative GTP-binding protein [putative GTP binding protein]
GTGTCGCTCACGATCGGAATCGTCGGTCTGCCGAATGTCGGCAAGTCGACCCTGTTCAAC
GCCCTGACCAAGAACGACGTGCTGGCGGCCAACTACCCGTTCGCCACGATCGAGCCCAAC
GTCGGTGTCGTGGGCGTCCCCGACGCACGCCTCACCAAGTTGGCCGAGATCTTCTCCTCC
CAGCGCATCCTCCCGGCGACCGTCGACTTCGTCGACATCGCCGGCATCGTGCGCGGCGCC
TCCGAGGGGGAGGGCCTGGGCAACAAGTTCCTCGCGAACATCCGTGAGTCCGACGCGATC
TGCCAGGTCATCCGCGCCTTCAAGGACGAGAACGTCGTCCATGTCGACGGCAAGGTCTCG
CCCAAGGACGACATCGAGACGATCAACACCGAGCTGATCCTCGCGGACCTCCAGACGATC
GAGAAGGTCCTGCCCCGCCTCCAGAAGGACTCGCGGATCAAGAAGGACCTCGCGCCGAAG
GTGAAGGCCGTCGAGGAGGCCAAGGAGATCCTGGAGAGGGGCGACACCCTCTTCGCCCAC
GGCATCGTCCAGGGCACCGAGCGCAACGAGCTCCTGCACGACCTGCACCTGCTCACCACC
AAGCCCTTCCTCTACGTCTTCAACGTCGACGAGGACGAGCTGATCGACGAGGACTTCAAG
AACGAGCAGCGCGCCCTGGTCGCCCCCGCCGAGGCCATCTTCCTCAACGCCAAGCTGGAG
GCCGACCTCGCCGAGCTCGACGACGACGAGGCCCTCGAACTCCTCCAGTCCGTCGGCCAG
GACGAGCCCGGCCTCGCCACCCTCGCCCGCGTCGGCTTCAACACCCTCGGCCTGCAGACC
TACCTGACGGCCGGCCCGAAGGAATCCCGCGCCTGGACCATCAAGAAGGGCGCCACCGCC
CCCGAGGCCGCCGGCGTCATCCACACCGACTTCCAGAAGGGCTTCATCAAGGCGGAGGTC
ATCTCCTTCACCGACCTGGTGGAGACCGGCTCCGTCGCCGAGGCCCGCGCGAAGGGGAAG
GCGCGTATGGAGGGCAAGGACTATGTGATGCAGGACGGGGACGTGGTCGAGTTCCGCTTC
AACGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004396 Conserved hypothetical protein CHP00092 (Family)
 [1-362]  TIGR00092
TIGR00092   TIGR00092
 [1-362]  PIRSF006641
PIRSF006641   CHP00092
IPR006073 GTP binding domain (Domain)
 [5-25]  3.1999989904635e-34 PR00326 [26-44]  3.1999989904635e-34 PR00326 [70-85]  3.1999989904635e-34 PR00326 [87-105]  3.1999989904635e-34 PR00326
PR00326   GTP1OBG
 [5-113]  5.69999999999998e-20 PF01926
PF01926   MMR_HSR1
IPR012675 Beta-grasp domain (Domain)
 [267-362]  2.99999999999998e-48 G3DSA:3.10.20.30
G3DSA:3.10.20.30   Ferredoxin_fold
IPR012676 TGS-like (Domain)
 [278-362]  4.60000044330862e-36 SSF81271
SSF81271   TGS-like
IPR013029 Domain of unknown function DUF933 (Domain)
 [278-361]  4.6e-40 PF06071
PF06071   YchF-GTPase_C
IPR023192 TGS-like domain (Domain)
 [119-192]  4.29999999999998e-18 G3DSA:1.10.150.300
G3DSA:1.10.150.300   G3DSA:1.10.150.300
SignalP
 [1-29]  0.382 Signal
Bacteria, Gram-positive   
 [1-29]  0.206 Signal
Eukaryota   
TMHMM No significant hit
first first   Avil_00020 Avil_00020