close all open/close all

CDS information : Avil_00020


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction2,870 / 3,151 / + [in whole cluster]
2,870 / 3,151 / + [in contig]
Location2870..3151 [in whole cluster]
2870..3151 [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative antitoxin
Product (GenBank)AviX2
GeneaviX2
yefM
Gene (GenBank)aviX2
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9Z4V7
PmId
[22431991] Identification of the first functional toxin-antitoxin system in Streptomyces. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>putative antitoxin [AviX2]
MSINRERSRKALFPLIKKVNDNHEAIEIVSKHGNAVLVSAEDYAALREGSYLLRSPANAR
RLLKAYENALAHVNVSERELIDPDSADAGSGAA
selected fasta
>putative antitoxin [AviX2]
ATGTCGATAAACCGCGAGCGAAGCCGCAAGGCTCTCTTTCCGCTGATCAAGAAGGTCAAC
GACAATCACGAGGCCATCGAGATCGTCTCCAAGCACGGCAACGCCGTACTCGTCTCGGCC
GAGGATTATGCAGCGCTGCGCGAGGGCTCGTACCTGCTGCGCTCTCCGGCGAACGCCCGT
CGACTGCTCAAGGCGTACGAGAACGCCCTTGCCCACGTCAATGTGTCGGAGCGGGAGCTG
ATCGATCCGGATTCGGCGGACGCTGGTTCGGGTGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006442 Type II toxin-antitoxin system, antitoxin Phd/YefM (Family)
 [13-64]  5.5e-10 PF02604
PF02604   PhdYeFM_antitox
 [12-54]  2.8e-07 TIGR01552
TIGR01552   Phd_fam
SignalP No significant hit
TMHMM No significant hit