close all open/close all

CDS information : Avil_00030


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction3,148 / 3,402 / + [in whole cluster]
3,148 / 3,402 / + [in contig]
Location3148..3402 [in whole cluster]
3148..3402 [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative toxin
Product (GenBank)AviX3
GeneaviX3
yoeB
Gene (GenBank)aviX3
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9Z4V8
PmId
[22431991] Identification of the first functional toxin-antitoxin system in Streptomyces. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>putative toxin [AviX3]
MRLVFEDQGWDDYTSWLKNDRKMLARINKLIEDVRRDPFTGIGKPEPLKYHLPGAWSRRI
DDEHRLVYLVTDKEIVILAARYHY
selected fasta
>putative toxin [AviX3]
GTGAGGCTTGTCTTCGAGGATCAGGGCTGGGATGACTACACGTCCTGGCTCAAGAACGAC
CGCAAGATGCTCGCCCGCATCAACAAGCTCATCGAGGACGTCAGGCGCGACCCCTTCACG
GGGATCGGCAAACCCGAGCCGCTGAAGTACCACTTGCCGGGGGCGTGGTCGCGGCGGATC
GACGACGAACACCGCCTCGTGTACCTGGTTACGGACAAGGAGATCGTGATCCTCGCTGCC
CGGTACCACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009614 Addiction module toxin, Txe/YoeB (Family)
 [5-84]  4.2e-39 TIGR02116
TIGR02116   Toxin_Txe_YoeB
 [5-84]  1.5e-41 PF06769
PF06769   Plasmid_Txe
SignalP No significant hit
TMHMM No significant hit