close all open/close all

CDS information : Avil_00040


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction4,310 / 3,624 / - [in whole cluster]
4,310 / 3,624 / - [in contig]
Locationcomplement(3624..4310) [in whole cluster]
complement(3624..4310) [in contig]
TypeCDS
Length687 bp (228 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AviX4
Gene
Gene (GenBank)aviX4
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [AviX4]
MILHSRFWRVDADRTYGISGTGLDWELDWSAPWEHLVEESHTWSLLEASEAPVGGSIFVA
PTWIDRTDLYPERWPMPFQHSEESGYGYVIERYVTSKDSDRPRCRDLKSGRVLRPGWPHA
ERFTRHLIDDAATITHAEWEALLGYEWRSRLTAAWLIGVGRRATFRERIGDLPPASEFCF
SGGAHCFTLARFGTHADAEILTGTDRQMIPSNWSALALWTGPYCPIGR
selected fasta
>hypothetical protein [AviX4]
GTGATCCTCCACTCCCGGTTCTGGCGGGTGGACGCCGACCGCACGTACGGCATCTCCGGC
ACCGGCCTGGACTGGGAACTCGACTGGAGCGCGCCCTGGGAACACCTGGTCGAAGAGTCC
CACACCTGGTCCCTGCTGGAAGCCTCCGAAGCCCCCGTCGGCGGCAGCATCTTCGTCGCC
CCCACCTGGATCGACCGTACCGATCTGTACCCGGAGAGGTGGCCGATGCCGTTCCAGCAC
TCCGAGGAGAGCGGCTACGGCTACGTGATCGAGCGCTACGTGACGAGCAAGGACTCGGAC
CGCCCGCGCTGCCGCGACCTGAAAAGCGGTCGCGTCCTGCGGCCCGGGTGGCCCCACGCC
GAACGCTTCACCCGTCACCTCATCGACGACGCAGCCACGATCACCCATGCCGAGTGGGAG
GCCCTCCTCGGCTACGAGTGGCGCTCACGCCTCACCGCCGCCTGGCTGATCGGCGTAGGC
CGACGCGCCACGTTCCGCGAACGCATCGGCGACCTGCCCCCGGCCAGCGAGTTCTGCTTC
TCCGGCGGCGCCCACTGCTTCACCCTGGCCCGCTTCGGCACCCACGCCGACGCCGAGATC
CTCACCGGTACGGACCGCCAGATGATCCCTTCCAACTGGTCCGCGCTGGCGCTCTGGACA
GGGCCCTACTGCCCGATCGGCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit