close all open/close all

CDS information : Avil_00060


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction4,931 / 5,794 / + [in whole cluster]
4,931 / 5,794 / + [in contig]
Location4931..5794 [in whole cluster]
4931..5794 [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Product23S rRNA (uridine2479-2'-O)-methyltransferase
Product (GenBank)rRNA methyltransferase
Gene
Gene (GenBank)aviRb
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • AviRb
Reference
ACC
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[12828631] The avilamycin resistance determinants AviRa and AviRb methylate 23S rRNA at the guanosine 2535 base and the uridine 2479 ribose. (Mol Microbiol. , 2003)
[15581897] Structure and function of the antibiotic resistance-mediating methyltransferase AviRb from Streptomyces viridochromogenes. (J Mol Biol. , 2005)

close this sectionSequence

selected fasta
>23S rRNA (uridine2479-2'-O)-methyltransferase [rRNA methyltransferase]
MARSRGERTPAARRITSRNARFQQWQALLGNRNKRTRAGEFLVMGVRPISLAVEHGWPVR
TLLYDGQRELSKWARELLRTVRTEQIAMAPDLLMELGEKNEAPPEVVAVVEMPADDLDRI
PVREDFLGVLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKSVRSSTGSLFSL
PAVRVPSPGEVMDWVEARRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSN
AWRTLCDYTVSIPMAGSASSLNAANAATAILYEAVRQRISGRTATTP
selected fasta
>23S rRNA (uridine2479-2'-O)-methyltransferase [rRNA methyltransferase]
ATGGCAAGATCACGTGGAGAGCGGACGCCGGCGGCTCGGCGGATCACCTCACGCAACGCT
CGTTTCCAGCAGTGGCAGGCACTGCTCGGCAACCGCAACAAGCGCACGCGCGCCGGTGAG
TTCCTGGTGATGGGAGTCCGCCCGATCTCGCTCGCGGTGGAGCACGGCTGGCCCGTACGC
ACGCTCCTCTACGACGGACAGCGGGAGCTGTCGAAGTGGGCGCGGGAGCTTCTTCGTACG
GTGCGGACGGAGCAGATCGCGATGGCCCCGGACCTGCTGATGGAGCTGGGGGAGAAGAAC
GAGGCCCCGCCCGAGGTCGTCGCCGTCGTGGAGATGCCCGCCGACGACCTCGACCGGATC
CCGGTCCGGGAGGACTTCCTGGGCGTACTGTTCGACCGGCCGACCAGTCCGGGGAACATC
GGCAGCATCATTCGCTCGGCGGATGCCCTGGGCGCGCACGGGCTGATCGTGGCGGGGCAC
GCCGCCGACGTCTACGACCCGAAATCGGTCCGGTCGAGCACCGGCTCGCTGTTCTCCCTG
CCCGCCGTCCGGGTGCCGTCACCGGGCGAGGTGATGGACTGGGTGGAGGCCCGCCGGGCC
GCCGGCACGCCGATCGTCCTGGTCGGTACGGACGAGCACGGCGACTGCGATGTGTTCGAC
TTCGACTTCACCCAGCCGACCCTGCTGCTGATCGGCAATGAGACAGCCGGGCTCAGCAAC
GCCTGGCGTACGTTGTGCGACTACACGGTCAGCATCCCGATGGCCGGCTCCGCGAGCTCG
CTGAACGCGGCGAACGCCGCGACCGCGATCCTCTACGAAGCGGTACGGCAGCGGATCAGC
GGAAGAACCGCAACAACTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001537 tRNA/rRNA methyltransferase, SpoU (Domain)
 [129-272]  7.10000000000008e-35 PF00588
PF00588   SpoU_methylase
SignalP No significant hit
TMHMM No significant hit