close all open/close all

CDS information : Avil_00090


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction6,489 / 6,830 / + [in whole cluster]
6,489 / 6,830 / + [in contig]
Location6489..6830 [in whole cluster]
6489..6830 [in contig]
TypeCDS
Length342 bp (113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AviX8
Gene
Gene (GenBank)aviX8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [AviX8]
MATPPKWPSEIDYQAPVPGKRAGQFDLLVRQILPGLEHEHKMCSPAHVRLHRKMPRDLLV
HPRKRAADPDLTARFTRRLHIGGNGLAESRLPMKIPGYEHPGFRHSALPRTHL
selected fasta
>hypothetical protein [AviX8]
GTGGCGACACCGCCCAAGTGGCCGTCAGAAATCGATTATCAGGCGCCGGTCCCTGGGAAA
CGAGCAGGCCAGTTCGATCTGCTCGTCCGACAGATACTGCCGGGCCTCGAACATGAACAC
AAGATGTGTTCCCCAGCGCACGTCCGGCTCCACCGGAAGATGCCGCGGGATCTGCTCGTC
CATCCGCGAAAGCGCGCCGCTGACCCGGACCTCACAGCCCGCTTCACCCGCCGCCTCCAC
ATAGGCGGCAACGGTCTGGCTGAATCCCGCCTGCCAATGAAGATTCCCGGCTACGAGCAC
CCGGGCTTCCGCCATTCCGCCCTCCCAAGGACACACCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit