close all open/close all

CDS information : Avil_00100


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction7,682 / 6,930 / - [in whole cluster]
7,682 / 6,930 / - [in contig]
Locationcomplement(6930..7682) [in whole cluster]
complement(6930..7682) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Product23S rRNA (guanine2535-N1)-methyltransferase
Product (GenBank)rRNA methyltransferase AviRa
Gene
Gene (GenBank)aviRa
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[12742024] Crystal structure of the avilamycin resistance-conferring methyltransferase AviRa from Streptomyces viridochromogenes. (J Mol Biol. , 2003)
[12828631] The avilamycin resistance determinants AviRa and AviRb methylate 23S rRNA at the guanosine 2535 base and the uridine 2479 ribose. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>23S rRNA (guanine2535-N1)-methyltransferase [rRNA methyltransferase AviRa]
MSAYRHAVERIDSSDLACGVVLHSAPGYPAFPVRLATEIFQRALARLPGDGPVTLWDPCC
GSGYLLTVLGLLHRRSLRQVIASDVDPAPLELAAKNLALLSPAGLTARELERREQSERFG
KPSYLEAAQAARRLRERLTAEGGALPCAIRTADVFDPRALSAVLAGSAPDVVLTDLPYGE
RTHWEGQVPAQPVAGLLRSLASALPAHAVIAVTDRSRKIPVAPVKALERLKIGTRSAVLV
RAADVLEAGP
selected fasta
>23S rRNA (guanine2535-N1)-methyltransferase [rRNA methyltransferase AviRa]
ATGAGTGCGTACCGCCACGCCGTGGAGCGGATCGACAGTTCCGATCTCGCCTGCGGTGTC
GTGCTCCACTCCGCGCCGGGTTACCCCGCCTTCCCCGTCCGCCTGGCGACCGAGATCTTC
CAGCGGGCCCTCGCCCGCCTCCCCGGCGACGGTCCGGTGACGCTGTGGGACCCGTGCTGC
GGCAGCGGTTACCTCCTGACGGTGCTGGGGCTGCTGCACCGGCGCTCGCTGCGGCAGGTG
ATCGCCTCCGATGTGGACCCCGCCCCGCTGGAGCTCGCGGCGAAGAATCTCGCCCTGCTC
TCGCCGGCCGGGCTGACCGCGCGCGAGCTCGAACGGCGTGAGCAGAGCGAGCGTTTCGGC
AAGCCCTCCTATCTGGAGGCCGCGCAGGCCGCCCGCCGGCTGCGGGAGCGCCTGACGGCG
GAGGGCGGTGCGCTGCCGTGCGCCATCCGCACCGCGGACGTCTTCGATCCGCGTGCGCTG
TCCGCCGTCCTCGCCGGGTCCGCGCCCGATGTCGTGCTGACCGACCTGCCGTACGGCGAG
CGCACGCACTGGGAAGGGCAGGTGCCCGCGCAGCCGGTGGCGGGCCTGCTGCGCTCGCTC
GCGTCGGCGCTGCCCGCGCATGCGGTGATCGCCGTCACCGACCGCAGCCGTAAGATCCCG
GTGGCTCCCGTAAAGGCCCTGGAGCGGCTGAAGATCGGCACCCGCTCGGCCGTACTGGTC
CGGGCAGCCGACGTGCTGGAGGCAGGCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023218 UPF0291 structural domain (Domain)
 [106-144]  1.4e-28 G3DSA:1.10.287.540
G3DSA:1.10.287.540   UPF0291_struct_dom
IPR024268 rRNA methyltransferase AviRa (Family)
 [1-246]  PF11599
PF11599   AviRa
SignalP No significant hit
TMHMM No significant hit