close all open/close all

CDS information : Avil_00110


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction7,935 / 8,903 / + [in whole cluster]
7,935 / 8,903 / + [in contig]
Location7935..8903 [in whole cluster]
7935..8903 [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NAD-dependent epimerase/dehydratase family protein
Product (GenBank)putative UDP-glucose 4-epimerase
Gene
Gene (GenBank)aviQ1
EC number
Keyword
Note
Note (GenBank)
  • AviQ1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9L5C0
PmId
[18266738] Characterization of the Bradyrhizobium japonicum galE gene: its impact on lipopolysaccharide profile and nodulation of soybean. (FEMS Microbiol Lett. , 2008)
ACC
P13226
PmId
[3335481] Gene organization and structure of the Streptomyces lividans gal operon. (J Bacteriol. , 1988)
Family/Domain
FD
IPR001509

close this sectionSequence

selected fasta
>putative NAD-dependent epimerase/dehydratase family protein [putative UDP-glucose 4-epimerase]
MSMFPGFSAGTRLLVTGGAGFIGSHVVDAFLEAGAEVTVLDDLTTGDPERLDPRAVIRRV
DVTDAAALDEAVRSARPDVICHLAAQIDVRVSVATPAVDARVNVEGTINVLEAAHAVGAR
VVFASTGGALYGEGVPVPTNEDTLPRPGAPYGTAKYCAEKYIGLFNRLHGTEHSVLRLGN
VYGPRQSPGGEAGVIAIYCGLASEGGVPTVFGDGSQTRDYVYVGDVAAAFVAPYGTVGPA
SGTSDTGKGSTVLEVLDHIAAASGRDLPPRFAPRRPGEIQHSTLDVTRVAADLGWTASVP
LEKGIAATYAWVRSGSPVRQQA
selected fasta
>putative NAD-dependent epimerase/dehydratase family protein [putative UDP-glucose 4-epimerase]
ATGTCCATGTTCCCGGGGTTCTCAGCCGGAACACGTCTGCTGGTGACCGGAGGGGCGGGC
TTCATCGGCTCGCACGTGGTCGACGCCTTCCTGGAGGCCGGGGCCGAGGTCACCGTGCTG
GACGACCTGACCACCGGTGACCCGGAACGTCTGGACCCACGTGCGGTCATCCGTCGCGTC
GACGTGACCGATGCCGCCGCCCTGGACGAGGCCGTGCGGTCGGCGCGCCCCGACGTCATC
TGCCATCTCGCGGCCCAGATCGACGTCCGGGTCTCGGTGGCCACACCGGCCGTCGACGCG
CGGGTCAACGTCGAGGGCACGATCAACGTGCTGGAAGCGGCGCACGCCGTCGGGGCGCGG
GTCGTGTTCGCCTCCACCGGCGGGGCGCTCTACGGGGAAGGCGTTCCGGTCCCGACGAAC
GAGGACACGCTGCCCAGGCCGGGGGCGCCCTACGGCACGGCCAAGTACTGCGCGGAGAAG
TACATCGGCCTGTTCAACCGGCTGCACGGAACCGAGCACAGCGTGTTGCGGCTCGGCAAC
GTGTACGGGCCCCGGCAGAGCCCGGGCGGTGAGGCGGGCGTCATCGCCATCTACTGCGGG
CTGGCCTCCGAGGGCGGAGTGCCCACGGTGTTCGGCGACGGTTCGCAGACCCGTGACTAC
GTGTACGTCGGCGACGTCGCCGCGGCGTTCGTCGCGCCGTACGGCACCGTCGGCCCGGCG
TCTGGAACATCGGACACGGGCAAGGGGAGCACGGTGCTGGAGGTCCTCGACCACATCGCC
GCCGCCTCCGGGCGCGACCTGCCTCCCCGTTTCGCGCCCCGCCGGCCGGGCGAGATCCAG
CACAGCACCCTGGACGTCACTCGTGTCGCCGCCGATCTGGGCTGGACCGCGTCCGTCCCG
CTGGAGAAAGGCATCGCCGCCACCTACGCCTGGGTCCGTTCCGGTTCGCCCGTCCGGCAG
CAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [14-232]  7.69999999999997e-53 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [6-181]  3.29999999999997e-53 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR025308 UDP-glucose 4-epimerase C-terminal domain (Domain)
 [260-312]  1.3e-06 PF13950
PF13950   Epimerase_Csub
SignalP
 [1-29]  0.799 Signal
Eukaryota   
TMHMM No significant hit