close all open/close all

CDS information : Avil_00120


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction9,740 / 9,018 / - [in whole cluster]
9,740 / 9,018 / - [in contig]
Locationcomplement(9018..9740) [in whole cluster]
complement(9018..9740) [in contig]
TypeCDS
Length723 bp (240 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)aviGT2
EC number
Keyword
Note
Note (GenBank)
  • AviGT2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [putative glycosyltransferase]
MVVAVCAFRLENVRRHLRHNLDQLNGDEYVVLLDRPVTPEAEKVATQVNEAGGTMRILGA
TRGLSASRNTVLREWADRHVLFVDDDVRLEASAVDAVRAAFRAGAHVVGARLRPPRELRR
LPWFLSSGQFHLVGWHRDRGDIKIWGACMGVDADFARRQGLTFDLDLSRTGVNLQSGEDT
SFIALMKEAGARELPAARARGRPRCRPRPAHPPLPPAPGLLAGCVRRRDGTSRRRDSARS
selected fasta
>hypothetical protein [putative glycosyltransferase]
ATGGTGGTGGCGGTCTGTGCCTTCCGTCTGGAGAACGTCCGCCGGCATCTGCGGCACAAC
CTCGACCAGTTGAACGGTGACGAATACGTCGTGCTGCTGGACCGGCCGGTGACACCTGAG
GCCGAGAAGGTCGCCACCCAGGTGAACGAGGCCGGGGGGACGATGCGGATCCTGGGGGCC
ACGCGAGGGCTGTCGGCGTCCCGTAACACGGTGCTGCGGGAATGGGCCGACCGGCACGTG
CTGTTCGTGGACGACGACGTGCGGCTGGAGGCCTCCGCCGTGGACGCCGTCCGCGCCGCG
TTCCGCGCCGGGGCGCACGTGGTCGGTGCGCGGCTGCGACCGCCGCGAGAGCTCCGCCGG
CTGCCCTGGTTCCTGTCCTCGGGGCAGTTCCACCTCGTCGGCTGGCACCGCGACCGCGGG
GACATCAAGATCTGGGGCGCCTGCATGGGCGTCGACGCCGACTTCGCGCGCCGCCAGGGC
CTCACCTTCGACCTGGACCTGAGCCGCACCGGCGTCAACCTGCAGTCCGGTGAGGACACC
TCCTTCATCGCGCTGATGAAGGAGGCGGGTGCGCGCGAGCTGCCTGCTGCCCGAGCACGC
GGTCGTCCACGATGTCGACCCCGGCCGGCTCACCCTCCGCTACCTCCTGCGCCGGGCCTA
CTGGCAGGGTGCGTTCGGAGGCGCGACGGCACCAGTCGGCGGCGGGACTCCGCAAGGAGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit