close all open/close all

CDS information : Avil_00140


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction11,680 / 11,060 / - [in whole cluster]
11,680 / 11,060 / - [in contig]
Locationcomplement(11060..11680) [in whole cluster]
complement(11060..11680) [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)putative two-component regulator
Gene
Gene (GenBank)aviC1
EC number
Keyword
Note
Note (GenBank)
  • AviC1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[19609289] Production of avilamycin A is regulated by AviC1 and AviC2, two transcriptional activators. (J Antibiot (Tokyo). , 2009)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [putative two-component regulator]
MPCTHRARAALSALPTPRRALLTTAGGTKAPQPGRRCDKMIKMSNVQDPFVAWVVSPSRL
HSSVVAPFGALILDASDDLLGHARTTRSYGGQTLPYSGCDSSDSGDDRFLHEDQFPWLEG
LSQVHLLSDRELQVFLLLSHGYSNREIAALLGVTERTVKAHMAQILAKLGVESRLQAGLV
AFAHGLPGHIGDAEGSDHPPDTSAGS
selected fasta
>LuxR family transcriptional activator [putative two-component regulator]
TTGCCGTGCACACACCGGGCACGGGCCGCCTTATCCGCCTTGCCCACGCCTCGGCGGGCC
CTGCTCACGACAGCAGGCGGCACCAAGGCGCCCCAACCCGGCCGTAGATGCGATAAGATG
ATCAAGATGAGTAATGTCCAGGACCCATTCGTCGCATGGGTGGTATCGCCCTCACGTCTT
CATAGTTCAGTGGTGGCGCCCTTCGGCGCCTTGATACTCGATGCGTCGGATGACCTCTTA
GGGCATGCAAGGACCACACGCTCATACGGGGGCCAGACTTTGCCATATTCCGGCTGCGAT
TCCAGTGATTCTGGCGACGATCGATTTCTCCACGAGGACCAGTTCCCCTGGCTGGAAGGG
CTCAGCCAGGTACATTTACTCTCCGACCGCGAGCTCCAGGTCTTCCTCCTGCTGAGCCAC
GGCTACTCCAACCGTGAGATCGCCGCGCTGCTCGGGGTCACCGAGCGCACCGTCAAGGCT
CATATGGCCCAGATACTGGCGAAGCTCGGGGTCGAATCCCGTCTTCAGGCCGGACTGGTT
GCCTTCGCCCACGGGCTTCCCGGACACATCGGCGATGCAGAGGGATCCGACCATCCACCC
GATACGTCCGCGGGTTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [120-185]  PS50043
PS50043   HTH_LUXR_2
 [124-181]  1.20000117458134e-24 SM00421
SM00421   HTH_LUXR
 [127-141]  1.09999909120787e-12 PR00038 [141-157]  1.09999909120787e-12 PR00038 [157-169]  1.09999909120787e-12 PR00038
PR00038   HTHLUXR
 [126-178]  3.1e-16 PF00196
PF00196   GerE
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [123-186]  5.30000000000001e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [105-191]  3.1999989904635e-20 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-20]  0.776 Signal
Bacteria, Gram-negative   
 [1-22]  0.637 Signal
Bacteria, Gram-positive   
TMHMM No significant hit