close all open/close all

CDS information : Avil_00150


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction12,529 / 11,951 / - [in whole cluster]
12,529 / 11,951 / - [in contig]
Locationcomplement(11951..12529) [in whole cluster]
complement(11951..12529) [in contig]
TypeCDS
Length579 bp (192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)putative response regulator
Gene
Gene (GenBank)aviC2
EC number
Keyword
Note
Note (GenBank)
  • AviC2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[19609289] Production of avilamycin A is regulated by AviC1 and AviC2, two transcriptional activators. (J Antibiot (Tokyo). , 2009)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [putative response regulator]
MPVTRGFAAGTGTPQRGMRPLHPGAPQLPSRRSLLRTAMIVKSGQPAAGPRNPPHLLEQP
NVQEPRPAPERKSTTAGERVLGTKESAAGAWSRPGALDTSQHSSPREYQVRTAPTTLSSL
DAKIIERIAAGERTTCIASKLYLSRQGVEYHVSKMMERFRVPNRTALVAKAYALGILRSE
VWPPRVLQERVN
selected fasta
>LuxR family transcriptional activator [putative response regulator]
ATGCCTGTTACCCGCGGTTTCGCGGCCGGAACGGGCACGCCACAGCGCGGGATGCGGCCG
TTACACCCCGGAGCGCCTCAACTACCGAGCCGTCGCAGCCTCTTGCGGACCGCCATGATC
GTGAAGTCCGGTCAGCCGGCCGCAGGCCCCCGAAACCCGCCCCATTTGCTCGAACAACCC
AATGTCCAAGAACCGCGACCGGCACCTGAACGAAAGTCCACTACTGCTGGTGAACGAGTG
TTGGGTACAAAGGAGTCAGCCGCCGGTGCCTGGTCCCGCCCCGGCGCTCTCGACACCTCT
CAGCACTCTTCCCCCAGGGAGTACCAGGTGAGAACCGCCCCCACGACCTTATCCAGCCTG
GACGCCAAGATCATCGAACGCATCGCCGCAGGTGAGCGCACCACCTGCATCGCCAGCAAG
CTCTACCTCAGCCGCCAGGGGGTCGAGTACCACGTCAGCAAGATGATGGAGCGCTTCCGG
GTGCCCAACCGCACCGCCCTCGTCGCCAAGGCCTACGCGCTGGGAATCCTGAGATCCGAG
GTGTGGCCCCCCAGGGTTCTGCAGGAACGCGTCAATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [116-171]  5.90000000000001e-10 PF00196
PF00196   GerE
 [114-171]  2.00000075217457e-06 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [107-177]  4.1e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [95-177]  5.29999657550189e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit