close all open/close all

CDS information : Avil_00160


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction12,685 / 13,095 / + [in whole cluster]
12,685 / 13,095 / + [in contig]
Location12685..13095 [in whole cluster]
12685..13095 [in contig]
TypeCDS
Length411 bp (136 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AviX10
Gene
Gene (GenBank)aviX10
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [AviX10]
MKIDVLQPTCNLDTVRDGRGGIFTWVPPEPILEFNMLHLYPGKVRGLHYHPHFVEYLLFV
EGSGVLITKDDAEDPNCKEEFIHVSRGVCTRTPAGVMHSVHAISSLTFIAMLTKPWDECD
PPLVQVEPLPHTLERP
selected fasta
>hypothetical protein [AviX10]
ATGAAAATCGATGTGCTGCAGCCGACCTGTAACCTGGATACGGTGCGGGACGGGCGCGGC
GGAATTTTCACCTGGGTCCCCCCGGAGCCCATCCTGGAATTCAATATGCTGCACCTGTAC
CCGGGAAAGGTGCGCGGCCTGCATTATCACCCGCACTTTGTCGAGTACCTGCTGTTCGTC
GAGGGCTCGGGCGTGCTGATCACCAAGGACGACGCCGAAGACCCCAACTGCAAAGAGGAA
TTCATCCACGTCTCGCGCGGGGTCTGCACCAGGACGCCGGCCGGGGTCATGCACTCCGTC
CACGCCATCTCGTCCCTGACGTTCATCGCCATGCTCACCAAGCCCTGGGACGAATGCGAT
CCGCCGCTGGTTCAGGTCGAGCCGCTGCCGCACACGCTGGAGCGCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [15-118]  4.79999776836274e-15 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [37-104]  7e-05 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [24-117]  3.3e-11 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-46]  0.074 Signal
Eukaryota   
TMHMM No significant hit