close all open/close all

CDS information : Avil_00180


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction13,784 / 15,007 / + [in whole cluster]
13,784 / 15,007 / + [in contig]
Location13784..15007 [in whole cluster]
13784..15007 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-3 C-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)aviG1
EC number2.1.1.-
Keyword
  • 2-deoxy-D-evalose
Note
Note (GenBank)
  • AviG1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[11832501] Analysis of a C-methyltransferase gene (aviG1) involved in avilamycin biosynthesis in Streptomyces viridochromogenes Tu57 and complementation of a Saccharopolyspora erythraea eryBIII mutant by aviG1. (Microbiology. , 2002)
Related Reference
ACC
A4F7P8
PmId
[15610855] Engineering biosynthetic pathways for deoxysugars: branched-chain sugar pathways and derivatives from the antitumor tetracenomycin. (Chem Biol. , 2004)
ACC
Q9XC68
PmId
[11180386] Insights into the Branched-Chain Formation of Mycarose: Methylation Catalyzed by an (S)-Adenosylmethionine-Dependent Methyltransferase We are grateful to Dr. Eugene Seno and the Lilly Research Laboratories for their generous gift of the plasmid pHJL311 and to the National Institutes of Health for grants (GM 35 906 and 54 346). H.-w.L. also thanks the National Institute of General Medical Sciences for a MERIT Award. T.M.H. was a trainee of the National Institute of General Medical Sciences (Biotechnology Training Grant: 2 T32 GM08347). (Angew Chem Int Ed Engl. , 2001)

close this sectionSequence

selected fasta
>NDP-hexose C-3 C-methyltransferase [methyltransferase]
MSTTGHSTVIDRCRICDNTELLPVLDLGPQALTGVFPRTRGEDVPYVPLELVRCSPGGCE
LVQLRHTADFGLMYGEGYGYRSSLNRSMADHLRGKVAAITGLVDLGPGDLVVDIGSNDGT
LLAAYPADGPRLVGVDPAATVFAASYPPGVELIPDFFAYDLLGGRRAKVVTSIAMFYDLP
RPMEFMREVGRLLTDDGIWVTEQSYLPAMLHACAYDVVCHEHLDYYGLRQIEWMAERTGL
KVVDAELTPVYGGSLSLVLARRGSSRQVNEPALARIRAGETDLPYAEFARRTEESRDRLL
EFLTASRDKGLHTLGYGASTKGNVILQYCGLDETLLPCIAEVNEDKFGCYTPGTNIPIVS
EEEARALEPDQFLVLPWIYRDAMVARERDFLASGGSLVFPLPTLEVV
selected fasta
>NDP-hexose C-3 C-methyltransferase [methyltransferase]
ATGAGCACGACCGGTCACTCGACCGTCATCGACCGTTGCCGGATCTGCGACAACACCGAG
TTGCTGCCCGTGCTCGACCTCGGACCGCAGGCCCTCACCGGCGTGTTCCCGCGGACCCGC
GGCGAGGACGTGCCGTACGTTCCGCTGGAGCTGGTGCGCTGCTCGCCCGGCGGTTGCGAA
CTGGTGCAGCTGCGCCACACCGCCGACTTCGGCCTCATGTACGGCGAGGGCTACGGCTAC
CGGTCCAGCCTCAACCGCTCCATGGCGGACCACCTGCGCGGCAAGGTCGCCGCCATCACC
GGCCTGGTCGACCTCGGCCCCGGCGACCTGGTCGTGGACATCGGCAGCAACGACGGCACC
CTGCTGGCGGCCTACCCCGCCGACGGGCCCCGCCTGGTCGGAGTGGACCCCGCCGCCACC
GTCTTCGCCGCGTCCTACCCGCCGGGCGTCGAGCTGATCCCCGACTTCTTCGCATACGAC
CTGCTCGGCGGGCGCCGCGCCAAGGTCGTCACCTCGATCGCGATGTTCTACGACCTGCCG
CGTCCCATGGAGTTCATGCGGGAGGTCGGCCGCCTGCTGACGGACGACGGCATCTGGGTG
ACCGAGCAGAGCTATCTGCCCGCGATGCTCCACGCCTGCGCCTACGACGTGGTCTGCCAC
GAGCACCTGGACTACTACGGGCTGCGCCAGATCGAGTGGATGGCCGAGCGCACCGGCCTG
AAGGTGGTGGATGCCGAGCTGACCCCCGTCTACGGCGGAAGCCTCTCGCTCGTGCTGGCC
CGCCGCGGCTCCTCTCGCCAGGTCAACGAGCCGGCGCTGGCCCGCATCCGCGCCGGAGAG
ACGGACCTGCCCTACGCGGAGTTCGCCCGGCGGACCGAGGAGTCCCGTGACCGACTCCTG
GAATTCCTCACCGCCTCGCGGGACAAGGGGCTGCACACCCTTGGCTACGGCGCCTCGACG
AAGGGCAACGTCATCCTGCAGTACTGCGGCCTGGACGAGACGCTCCTGCCCTGCATCGCC
GAGGTGAACGAGGACAAGTTCGGCTGCTACACGCCCGGCACGAACATCCCGATCGTCTCC
GAGGAGGAGGCCCGGGCGCTTGAGCCCGACCAGTTCCTGGTCCTCCCGTGGATCTACCGG
GACGCGATGGTCGCCCGGGAACGCGACTTCCTGGCCTCCGGAGGCAGCCTGGTCTTTCCG
CTGCCCACGCTGGAAGTTGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [13-75]  1.3e-21 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [249-402]  8.70000000000003e-51 PF08484
PF08484   Methyltransf_14
SignalP
 [1-41]  0.117 Signal
Eukaryota   
TMHMM No significant hit