close all open/close all

CDS information : Avil_00190


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction15,012 / 16,442 / + [in whole cluster]
15,012 / 16,442 / + [in contig]
Location15012..16442 [in whole cluster]
15012..16442 [in contig]
TypeCDS
Length1,431 bp (476 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)putative transporter
Gene
Gene (GenBank)aviJ
EC number
Keyword
Note
Note (GenBank)
  • AviJ
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q6BJU7
PmId
[17559408] Characterization of DhKHA1, a gene coding for a putative Na(+) transporter from Debaryomyces hansenii. (FEMS Yeast Res. , 2007)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [putative transporter]
MAEVTSRGTTRVLAVCLLSVLPLLAAALLLWHGTTGKDDASRPGSGSATPGDAPHVEAWR
LLLALAVVVAVARACGALVGRHLGQPRVVGEMISGIVLGPSVLGLVAPGVHDALFPAALH
SYLDLVAQIGLALFMFLIGMEFGDTHHEGAGRTGAAVGIVGVCVSFALGCALGYALYTGY
APDGVGFLPFTLFLGIAMSVTAFPVLARLLMERGMLQSRAGTYAIVGAATADLACWLLLA
GLVALLRGGSPLGVLRTLALTAVFFGVMVVLVRPALRRVLERPERRLPDGGVLTLIIPGV
LLSAVATELIGIHLIFGAFLFGAICPKTAPALADARGKLQELVTAVLLPPFFASVGLKTD
LLQLGRGGGALWVWAGVALLVAVVGKLAGSAAAAALMSVERVDALRIGVLMNCRGLTELV
ILTIGLELGVLTPALFTMLVIVTLCATVMTAPLLDLLDRAEARTAPARTKASSVVR
selected fasta
>putative transporter [putative transporter]
GTGGCGGAGGTGACATCGCGCGGCACCACCCGCGTGCTTGCCGTGTGCCTGCTGTCGGTG
CTGCCGCTGCTGGCCGCGGCCCTGCTGCTGTGGCACGGCACCACGGGCAAGGACGACGCG
TCGCGACCCGGCTCCGGGAGTGCCACGCCGGGGGATGCGCCGCATGTCGAGGCGTGGCGG
TTGCTGCTCGCCCTCGCCGTGGTGGTGGCCGTCGCGCGGGCCTGCGGAGCGCTGGTCGGC
CGGCACTTGGGCCAGCCACGCGTGGTGGGCGAGATGATCTCCGGGATCGTTCTCGGCCCT
TCGGTGCTCGGCCTCGTCGCTCCCGGGGTCCACGACGCCCTCTTCCCCGCCGCCCTCCAC
TCCTACCTCGATCTCGTCGCCCAGATCGGGCTGGCGCTGTTCATGTTCCTGATCGGCATG
GAGTTCGGTGACACCCACCATGAAGGCGCGGGCCGCACCGGGGCCGCCGTGGGAATCGTC
GGCGTCTGCGTGTCGTTCGCCCTCGGCTGTGCTCTGGGATACGCGCTGTACACCGGCTAC
GCCCCGGACGGCGTCGGCTTCCTGCCGTTCACCCTCTTCCTGGGCATCGCCATGAGCGTG
ACCGCCTTCCCCGTGCTGGCGCGGCTGCTGATGGAACGCGGGATGCTCCAGTCCCGGGCG
GGCACCTACGCCATCGTGGGGGCCGCCACCGCCGATCTCGCCTGCTGGCTGCTGCTCGCG
GGTCTCGTCGCCCTGTTGCGCGGCGGTTCGCCCCTGGGCGTGCTGCGCACCCTCGCGCTC
ACCGCGGTCTTCTTCGGCGTCATGGTGGTGCTCGTCCGCCCCGCCTTGCGACGCGTCCTG
GAGCGGCCGGAGCGCCGGCTGCCCGACGGCGGCGTGCTCACACTGATCATCCCCGGCGTC
CTGCTGTCCGCGGTCGCCACCGAGCTCATAGGCATCCATCTCATCTTCGGCGCCTTCCTG
TTCGGCGCCATCTGCCCGAAGACCGCGCCGGCCCTGGCGGACGCCCGCGGCAAACTGCAG
GAACTCGTCACCGCCGTACTGTTGCCGCCGTTCTTCGCCTCGGTCGGCCTGAAGACCGAC
CTGCTGCAACTCGGCCGGGGCGGCGGCGCCCTGTGGGTGTGGGCCGGCGTCGCCCTGCTG
GTGGCCGTCGTCGGCAAACTGGCGGGCAGCGCGGCGGCAGCGGCGCTGATGTCGGTGGAG
CGCGTCGACGCCCTGCGCATCGGCGTGCTCATGAACTGCCGCGGACTGACCGAACTGGTG
ATCCTCACCATCGGGCTCGAACTCGGCGTCCTGACACCCGCGTTGTTCACCATGCTGGTC
ATCGTCACCCTGTGCGCCACCGTCATGACCGCGCCGCTGCTCGACCTGCTCGACCGCGCC
GAGGCGCGCACCGCGCCCGCCCGTACAAAAGCGAGTTCCGTCGTTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [67-454]  2.29999999999998e-61 PF00999
PF00999   Na_H_Exchanger
SignalP
 [1-36]  0.967 Signal
Eukaryota   
 [1-27]  0.627 Signal
Bacteria, Gram-positive   
 [1-25]  0.973 Signal
Bacteria, Gram-negative   
TMHMM
 [12-34]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [93-115]  Transmembrane (i-o) [125-143]  Transmembrane (o-i) [156-178]  Transmembrane (i-o) [188-210]  Transmembrane (o-i) [223-245]  Transmembrane (i-o) [255-277]  Transmembrane (o-i) [290-312]  Transmembrane (i-o) [374-396]  Transmembrane (o-i) [409-431]  Transmembrane (i-o) [435-457]  Transmembrane (o-i)
Transmembrane 12