close all open/close all

CDS information : Avil_00200


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction16,593 / 17,624 / + [in whole cluster]
16,593 / 17,624 / + [in contig]
Location16593..17624 [in whole cluster]
16593..17624 [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)AviN
Gene
Gene (GenBank)aviN
EC number
Keyword
  • dichloroisoeverninic acid
Note
Note (GenBank)
Reference
ACC
PmId
[9335272] Cloning of an avilamycin biosynthetic gene cluster from Streptomyces viridochromogenes Tu57. (J Bacteriol. , 1997)
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q0R4P5
NITE
Chth_00090
PmId
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative acyltransferase [AviN]
MQIADLYIGALGVFVPPCVSVEWAVERGLYPAEEAEAHELGGVAIAGDVPPPEMALRAAQ
QAVKRWGGSPTEFDLLLYASTWHQGPDGWPPQAYLQRHLVGGDMLALEIRQGCNGVFSAL
ELAVGYLQADPNRTSALIVAADNYGTPLIDRWRMGPGFIGGDALPPWCCKRPGFARLCSV
ASKGLPEIESLHRGDEPLFPPSITRGRATDFSARIGQQFATRSPAFVAMAEIQDHMMDVA
ERALAGAGIGMADVARVSFMNYHAKWSSSAEWRPGGCRCPGPRGNSAGRSATCGASDHLL
SMEHIVRTGELAPGDHVLQLATAPGLVVSSAVLQVLESPDWDE
selected fasta
>putative acyltransferase [AviN]
GTGCAGATAGCCGACCTGTACATCGGTGCTCTCGGCGTCTTCGTACCGCCGTGTGTGAGC
GTCGAATGGGCCGTGGAACGCGGCCTCTATCCGGCCGAAGAGGCCGAGGCACACGAGCTC
GGCGGGGTCGCCATAGCCGGCGACGTCCCCCCTCCGGAAATGGCCTTGCGGGCGGCGCAG
CAGGCGGTGAAGAGGTGGGGCGGATCGCCGACGGAATTCGATCTGCTGCTGTATGCGAGC
ACCTGGCACCAGGGCCCGGACGGCTGGCCGCCCCAGGCATACCTGCAGCGGCACCTGGTG
GGCGGGGACATGCTCGCCCTGGAGATCAGGCAGGGCTGCAACGGCGTGTTCAGCGCGCTG
GAACTCGCCGTCGGCTACCTGCAGGCCGATCCGAACCGCACCAGCGCGCTGATCGTCGCC
GCCGACAACTACGGAACGCCGCTGATCGACCGGTGGCGGATGGGCCCCGGCTTCATCGGC
GGCGATGCGCTCCCGCCCTGGTGCTGCAAGCGGCCCGGCTTCGCCCGGCTCTGCTCGGTG
GCCTCCAAGGGGCTGCCGGAGATCGAGTCGCTGCACCGCGGTGACGAGCCGTTGTTCCCG
CCGAGCATCACCCGGGGCCGTGCCACCGACTTCAGCGCCCGTATCGGCCAGCAGTTCGCC
ACCCGCAGCCCCGCCTTCGTTGCGATGGCCGAGATTCAGGACCATATGATGGACGTGGCC
GAGCGCGCCCTGGCCGGGGCCGGCATCGGGATGGCGGACGTCGCCCGCGTCTCCTTCATG
AACTATCACGCGAAGTGGTCGAGCAGTGCTGAATGGCGGCCTGGGGGGTGCCGCTGTCCC
GGTCCACGTGGGAATTCGGCCGGGAGATCGGCCACTTGCGGGGCCAGCGACCATCTGCTG
TCCATGGAACACATCGTACGGACCGGTGAGCTCGCCCCCGGCGACCACGTCCTGCAACTC
GCCACGGCCCCGGGCCTGGTGGTGTCCAGCGCCGTCCTTCAGGTTCTCGAATCGCCGGAC
TGGGACGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [244-334]  1.8e-09 PF08541
PF08541   ACP_syn_III_C
IPR016038 Thiolase-like, subgroup (Domain)
 [47-160]  3.1e-15 G3DSA:3.40.47.10 [289-334]  5.9e-06 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [40-338]  2.39999798157265e-15 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-21]  0.14 Signal
Bacteria, Gram-positive   
 [1-20]  0.533 Signal
Eukaryota   
TMHMM No significant hit