close all open/close all

CDS information : Avil_00220


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction21,692 / 22,759 / + [in whole cluster]
21,692 / 22,759 / + [in contig]
Location21692..22759 [in whole cluster]
21692..22759 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative dTDP glucose synthetase
Gene
Gene (GenBank)aviD
EC number2.7.7.24
Keyword
  • D-olivose
  • 2-deoxy-D-evalose
Note
Note (GenBank)
  • AviD
Reference
ACC
PmId
[9335272] Cloning of an avilamycin biosynthetic gene cluster from Streptomyces viridochromogenes Tu57. (J Bacteriol. , 1997)
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[16242656] Genes encoding enzymes responsible for biosynthesis of L-lyxose and attachment of eurekanate during avilamycin biosynthesis. (Chem Biol. , 2005)
Related Reference
ACC
P08075
PmId
[3118332] Gene cluster for streptomycin biosynthesis in Streptomyces griseus: nucleotide sequence of three genes and analysis of transcriptional activity. (Nucleic Acids Res. , 1987)
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP glucose synthetase]
MKALILVGGVGSRLRPITHTSAKQLVPVANRTVLSYVLDSIKEAGISEVGIVVGATAAEI
QASVGDGAEFGLDVTYIQQDAPRGLADAVLVSRDFLGDDDFVMYLGDNYVVDGIVDFVAD
FRRDKPAAQVMLARVADPRRFGVAELDENGRVTAVVEKPQDPRSDLAIVGVYAFSSAVHE
AVAGIRPSWRNELEITDALQWLADHGHEVGSTVIDRYWKDVASVTDVLEMNRHLLESLET
RIDGEVDEASELVGRVVVEAGAKISGSRIVGPAVIGPDTVVQDSYLGPFTSIEGNCRVAH
SEIQYSIVLRGASIEGVARVEDSVIGRETEVNAAPRTSTAHRLVLGDHSRVQVGG
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP glucose synthetase]
ATGAAGGCGCTCATATTGGTGGGCGGGGTTGGCTCGAGGCTGCGGCCGATTACGCATACC
TCGGCCAAACAACTGGTCCCGGTGGCCAATAGAACTGTTCTCTCCTATGTACTGGATTCC
ATCAAGGAGGCCGGAATATCGGAGGTCGGGATTGTCGTCGGGGCGACCGCGGCGGAGATC
CAGGCTTCCGTGGGAGACGGCGCGGAGTTCGGCCTGGACGTCACCTACATCCAGCAGGAC
GCCCCGCGCGGGCTGGCCGACGCCGTGCTCGTGTCCCGTGACTTCCTCGGCGACGACGAC
TTCGTCATGTACCTGGGCGACAACTACGTCGTGGACGGCATCGTCGACTTCGTGGCGGAC
TTCCGCCGCGACAAGCCCGCCGCGCAGGTCATGCTCGCCCGGGTCGCCGACCCGCGCAGG
TTCGGCGTGGCCGAACTTGACGAGAACGGCCGGGTGACCGCGGTCGTGGAGAAGCCCCAG
GACCCCAGGAGCGACCTGGCGATCGTCGGCGTGTACGCCTTCAGCTCGGCCGTGCACGAG
GCCGTGGCCGGCATCCGGCCGTCCTGGCGGAACGAGCTGGAGATCACCGACGCCCTGCAG
TGGCTGGCCGACCACGGGCACGAGGTCGGCTCCACGGTGATCGACCGGTACTGGAAGGAC
GTCGCGAGCGTCACCGACGTCCTGGAGATGAACCGGCACCTGCTGGAGTCCCTGGAGACC
CGCATCGACGGCGAGGTGGACGAGGCCAGCGAACTGGTGGGCCGAGTCGTGGTGGAGGCG
GGGGCGAAGATCTCCGGCTCCCGCATCGTCGGTCCCGCCGTCATCGGCCCGGACACGGTG
GTGCAGGACTCCTACCTCGGTCCCTTCACCTCCATCGAGGGCAACTGCCGGGTCGCGCAC
AGCGAGATCCAGTACTCGATCGTGCTGCGTGGCGCTTCGATCGAGGGAGTCGCCCGTGTC
GAGGACTCGGTGATCGGCCGGGAGACCGAGGTGAACGCCGCCCCCCGGACGTCGACCGCG
CACCGGCTGGTGCTGGGAGACCACAGCCGGGTCCAGGTCGGCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  1.40000000000001e-58 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  3.10000000000005e-129 TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-14]  0.551 Signal
Eukaryota   
TMHMM No significant hit