close all open/close all

CDS information : Avil_00230


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction22,810 / 23,877 / + [in whole cluster]
22,810 / 23,877 / + [in contig]
Location22810..23877 [in whole cluster]
22810..23877 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative dTDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)aviE1
EC number4.2.1.46
Keyword
  • D-olivose
  • 2-deoxy-D-evalose
Note
Note (GenBank)
  • AviE1
Reference
ACC
PmId
[9335272] Cloning of an avilamycin biosynthetic gene cluster from Streptomyces viridochromogenes Tu57. (J Bacteriol. , 1997)
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
A8WEY5
PmId
[10650224] An efficient approach for cloning the dNDP-glucose synthase gene from actinomycetes and its application in Streptomyces spectabilis, a spectinomycin producer. (FEMS Microbiol Lett. , 2000)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose 4,6-dehydratase]
MRDGSAGAERGRHVLVIGGAGFIGSQYVRELVRDGDPARVTVLDKLTYAGNLANLEPVAG
RYTFVHGDICDARLLAEVVPGHDLVVNFAAESHVDRSIADAAPFIRTNVQGVQALMQVCL
EAGTARIVQVSTDEVYGSIETGSWDEDAPIAPNSPYAASKAGGDMVALAYARTHGLPVSV
TRCGNNYGPYQFPEKVVPLFTTRLLDGHSIPLYGDGGNVRDWVHVSDHVRGIRLVAERGL
PGQVYHIAGSAELTNLELTQQLLDALGAGWDRVERVPDRKGHDRRYSLCDARLGALGYAP
RVSFEQGLADTVRWYAENRDWWEPLNERALSDGMALAVPTAPMTRGEPARGLPLR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose 4,6-dehydratase]
ATGCGAGACGGCAGCGCGGGTGCGGAACGGGGACGGCACGTCCTGGTCATCGGTGGAGCG
GGCTTCATCGGCTCCCAGTACGTGCGCGAACTGGTCCGGGACGGCGATCCGGCGCGGGTG
ACCGTGCTGGACAAGCTGACCTACGCCGGGAACCTGGCGAACCTGGAGCCGGTCGCCGGC
CGGTACACCTTCGTGCACGGCGACATCTGCGATGCCAGGCTGCTCGCCGAGGTGGTCCCC
GGCCACGATCTGGTGGTCAACTTCGCGGCCGAATCGCACGTCGACCGGTCGATCGCCGAC
GCGGCGCCGTTCATACGTACCAATGTGCAGGGCGTCCAGGCACTCATGCAGGTGTGCCTG
GAGGCCGGCACGGCCAGGATCGTGCAGGTCTCCACCGACGAGGTGTACGGCAGCATCGAG
ACGGGCTCCTGGGACGAGGACGCGCCGATCGCCCCCAACTCGCCCTACGCGGCGTCCAAG
GCGGGCGGCGACATGGTCGCCCTCGCCTACGCCCGCACCCATGGGCTGCCGGTGAGCGTG
ACGCGGTGCGGCAACAACTACGGGCCCTATCAGTTCCCGGAGAAGGTCGTTCCGCTGTTC
ACCACCCGGCTGCTGGACGGCCACAGCATCCCGCTGTACGGGGATGGCGGCAACGTCCGG
GACTGGGTGCACGTGTCCGACCACGTGCGGGGCATCCGGCTGGTCGCCGAACGCGGGCTG
CCGGGGCAGGTCTACCACATCGCGGGCTCGGCCGAGCTGACCAATCTGGAACTGACGCAA
CAACTGCTGGACGCCCTGGGCGCCGGCTGGGACCGGGTCGAGCGTGTACCCGACCGGAAG
GGACACGACCGGCGCTACTCGCTGTGCGACGCCCGCCTCGGCGCGCTCGGCTACGCACCC
CGTGTGTCGTTCGAGCAAGGCCTCGCCGACACCGTGCGCTGGTACGCCGAGAACCGGGAC
TGGTGGGAGCCGTTGAACGAGCGCGCGCTGTCCGACGGCATGGCTCTGGCCGTGCCGACA
GCACCCATGACTAGGGGAGAGCCCGCCCGCGGGCTTCCCCTTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [14-248]  2.19999999999997e-63 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [14-325]  7.59999999999998e-120 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [10-195]  7.5e-61 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit