close all open/close all

CDS information : Avil_00240


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction23,925 / 24,953 / + [in whole cluster]
23,925 / 24,953 / + [in contig]
Location23925..24953 [in whole cluster]
23925..24953 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NAD-dependent epimerase/dehydratase family protein
Product (GenBank)putative NDP-glucose 4-epimerase
Gene
Gene (GenBank)aviQ2
EC number
Keyword
Note
Note (GenBank)
  • AviQ2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9L5C0
PmId
[18266738] Characterization of the Bradyrhizobium japonicum galE gene: its impact on lipopolysaccharide profile and nodulation of soybean. (FEMS Microbiol Lett. , 2008)
ACC
P13226
PmId
[3335481] Gene organization and structure of the Streptomyces lividans gal operon. (J Bacteriol. , 1988)
Family/Domain
FD
IPR001509

close this sectionSequence

selected fasta
>putative NAD-dependent epimerase/dehydratase family protein [putative NDP-glucose 4-epimerase]
MAHCLVTGGAGFIGSHVAEALLSRGHRVSVLDDLSGGTAERVPEGAHLFTGSVTDVELVD
RLFAEQRFDHVFHFAAFAAEAISHSVKSLNYGTNVMGSVNLINAALRTGVSFFCFASSVA
VYGHGETPMRESSIPVPADSYGNAKLTVERELETTMRTQGLPFTAFRMHNVYGEWQNMRD
PYRNAVAIFFNQILRGEPISVYGDGGQVRAFSYVKDIVDVIVRAPETEKAWGRAFNVGSS
RTNTVLELAQAVRAAAGVPSHPIAHLPARDEVMVAYTATEEAREVFGDWADTPLADGLAR
TAAWAASVGPAELRSSFEIEIGGERVPEWAQCVADRLSGADR
selected fasta
>putative NAD-dependent epimerase/dehydratase family protein [putative NDP-glucose 4-epimerase]
ATGGCGCACTGTCTGGTGACCGGCGGAGCCGGCTTCATCGGCTCGCATGTGGCGGAGGCT
CTGCTCAGCCGCGGGCACCGGGTATCGGTCCTCGACGACCTCAGCGGCGGCACCGCCGAG
CGTGTCCCCGAGGGCGCGCACCTGTTCACCGGGTCGGTGACCGATGTGGAGCTGGTCGAC
AGGCTCTTCGCCGAGCAGCGATTCGACCACGTCTTCCACTTCGCGGCGTTCGCGGCGGAG
GCGATCAGTCACTCGGTGAAGAGCCTCAACTACGGCACCAACGTGATGGGCAGCGTGAAC
CTCATCAACGCGGCGCTGCGAACCGGCGTCTCGTTCTTCTGTTTCGCGTCCTCCGTCGCG
GTGTACGGGCACGGCGAGACCCCGATGCGGGAGTCGTCGATCCCGGTACCGGCCGACAGT
TACGGCAACGCGAAACTCACGGTCGAGCGCGAGCTGGAAACGACGATGCGGACCCAGGGC
CTGCCCTTCACCGCATTCCGTATGCACAACGTGTACGGCGAATGGCAGAACATGCGCGAC
CCCTATCGCAATGCGGTCGCCATTTTCTTCAACCAGATCCTGCGCGGTGAGCCGATCTCG
GTCTACGGCGACGGCGGTCAGGTGCGGGCGTTCAGCTACGTCAAGGACATCGTGGACGTC
ATCGTGCGCGCCCCCGAGACGGAGAAGGCCTGGGGCCGGGCCTTCAACGTCGGCTCGTCC
CGCACCAACACCGTGCTGGAGCTGGCCCAGGCCGTGCGTGCGGCGGCCGGTGTCCCCAGC
CACCCCATCGCGCACCTGCCCGCCCGGGACGAGGTGATGGTCGCCTACACCGCCACCGAG
GAGGCCCGCGAGGTCTTCGGCGACTGGGCGGACACCCCGCTGGCGGACGGGCTCGCCCGG
ACCGCCGCGTGGGCCGCCTCCGTCGGCCCCGCCGAACTGCGCTCCTCCTTCGAGATCGAG
ATCGGCGGAGAGCGCGTCCCGGAGTGGGCGCAGTGTGTGGCCGACCGGCTGAGCGGCGCC
GACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-238]  1.9e-51 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [3-168]  2.89999999999999e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-20]  0.133 Signal
Bacteria, Gram-negative   
 [1-20]  0.718 Signal
Eukaryota   
TMHMM No significant hit