close all open/close all

CDS information : Avil_00250


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction25,011 / 25,610 / + [in whole cluster]
25,011 / 25,610 / + [in contig]
Location25011..25610 [in whole cluster]
25011..25610 [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-fucose C-4 O-methyltransferase
Product (GenBank)putative methyltransferase
Gene
Gene (GenBank)aviG5
EC number2.1.1.-
Keyword
  • 4-O-methyl-D-fucose
Note
Note (GenBank)
  • AviG5
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15489167] Novel avilamycin derivatives with improved polarity generated by targeted gene disruption. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>D-fucose C-4 O-methyltransferase [putative methyltransferase]
MNDLEIRRRVRELEPWVNDFVYNGVRYATASTRDYLLSQPPQERADAFFAAFPGAKRVLE
LGALEGADTLAMSGQPGVEILALEGREENLRRAEFVMEVHGVTNVELRLADVESMEFAGL
GHFDATLCAGLLYHVQRPWELLADIGSVSDCLYLSTHYWGSSDGMTDLDGTRSTPSAKTT
PSPRPAASASTCAGWTGRR
selected fasta
>D-fucose C-4 O-methyltransferase [putative methyltransferase]
GTGAACGATCTTGAGATTCGGCGTCGGGTACGTGAACTCGAGCCGTGGGTGAACGACTTT
GTGTACAACGGGGTCCGGTACGCCACCGCCTCCACGCGCGACTACCTGCTGAGCCAGCCG
CCCCAGGAGCGGGCCGACGCGTTCTTCGCGGCGTTCCCGGGGGCCAAGCGCGTCCTGGAG
CTCGGCGCGCTGGAGGGCGCGGACACCCTGGCGATGTCGGGACAGCCCGGCGTCGAGATC
CTCGCCCTGGAGGGCCGCGAAGAGAACCTGCGCCGCGCCGAGTTCGTCATGGAGGTGCAC
GGCGTCACCAACGTGGAACTCCGGCTCGCCGACGTGGAGTCGATGGAGTTCGCCGGGCTC
GGCCACTTCGACGCCACGCTCTGCGCAGGGCTCCTCTACCACGTGCAGCGGCCCTGGGAG
CTGCTCGCCGACATCGGCTCCGTCTCCGACTGCCTCTACCTCTCCACCCACTACTGGGGC
AGCTCGGACGGAATGACCGACCTCGACGGTACGCGGTCCACCCCGTCCGCGAAGACCACC
CCGAGCCCCAGGCCCGCGGCCTCAGCGTCGACGTGCGCTGGCTGGACCGGCCGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-30]  0.101 Signal
Bacteria, Gram-negative   
TMHMM No significant hit