close all open/close all

CDS information : Avil_00260


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction25,761 / 26,432 / + [in whole cluster]
25,761 / 26,432 / + [in contig]
Location25761..26432 [in whole cluster]
25761..26432 [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)putative oxygenase
Gene
Gene (GenBank)aviO1
EC number
Keyword
Note
Note (GenBank)
  • AviO1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15640214] Genes involved in formation and attachment of a two-carbon chain as a component of eurekanate, a branched-chain sugar moiety of avilamycin A. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative oxygenase]
MTTATLDRAAAIERFRRDGFANAGPVLAPDAIARLKAGAERLITRFTDEGLRSDDYWNFP
VEGDERPVLYRVHNLEKQDWAPERDLLHREELAQLAAAFVDGPVVPTAYALVLKEPYRAA
EVPWHRDRVNVGPRTVCNLSICLDDAGPHNGCLEAVPGSHLLPDDAEVAKVRATGPVVPV
PVSQGDVVVHDVRLVHGSGPNANGSWRRTIVIEYADPAAPPAP
selected fasta
>hypothetical protein [putative oxygenase]
ATGACCACGGCGACACTGGACCGGGCCGCGGCGATCGAGCGGTTCCGACGGGACGGCTTC
GCGAACGCGGGCCCGGTTCTCGCCCCGGACGCGATCGCCCGTCTCAAGGCGGGCGCCGAA
CGGCTCATCACCCGCTTCACCGACGAGGGCCTGCGCTCCGACGACTACTGGAACTTCCCC
GTCGAGGGCGATGAGCGTCCCGTCCTCTACCGCGTGCACAACTTGGAGAAGCAGGACTGG
GCCCCGGAACGGGACCTGCTGCACCGCGAGGAACTGGCGCAGCTCGCCGCCGCGTTCGTG
GACGGCCCGGTCGTGCCCACCGCCTACGCGCTCGTCCTCAAGGAGCCGTACCGGGCCGCG
GAGGTGCCATGGCACCGTGACCGCGTCAACGTCGGCCCGCGCACGGTCTGCAATCTGAGC
ATCTGCCTGGACGACGCCGGACCGCACAACGGATGCCTGGAGGCGGTTCCGGGATCGCAC
CTGCTCCCCGACGACGCCGAGGTGGCGAAGGTGCGCGCGACCGGACCCGTGGTTCCGGTC
CCGGTCAGCCAGGGCGACGTGGTGGTGCACGACGTCCGGCTCGTCCACGGTTCGGGCCCG
AACGCCAACGGCAGTTGGCGGCGGACCATCGTCATCGAGTACGCCGACCCGGCCGCACCG
CCGGCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [15-208]  1.2e-37 PF05721
PF05721   PhyH
SignalP No significant hit
TMHMM No significant hit