close all open/close all

CDS information : Avil_00270


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction26,490 / 27,782 / + [in whole cluster]
26,490 / 27,782 / + [in contig]
Location26490..27782 [in whole cluster]
26490..27782 [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)aviGT1
EC number
Keyword
Note
Note (GenBank)
  • AviGT1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q194P5
NITE
Mith_00300
PmId
[9733697] Identification of two genes from Streptomyces argillaceus encoding glycosyltransferases involved in transfer of a disaccharide during biosynthesis of the antitumor drug mithramycin. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative glycosyltransferase]
MRIMFTASNWAGHYMCMVPLAWALRAAGHEIRVACPPSQERGVAATGLMPVPVLDAPDMM
ESARLAFYVQAMYTPPQSGPRPLPLHPFTGQPMQSLNDFDAGDLRDFWKKSIDAVQRSYD
NAVSFGDHWRPDLVVHDIMAVEGALVAALRGVPSVYVSPGFIGTVETEPGLDLVSADPLS
CFEKYGVEWGRDRIQYAVDPSPDVAVPPLGDALRLPMRYVPYNGAQGADPWQLGPIRGRR
VCIVWGNSASGIFGADVPALRHAIDAAVRQGAEVVLTAPQEQVEELGALPAGVRVLRNCP
LELILPYCDLLVHHGSANCYMNGIVAGIPQLSLALNYDTLICGRRIDPAGATLTLSGLEA
TAEKVEEALRRVLFDHRYRRAAEKLRDGVERAPSPAAVAGLLTRLVADGGLSAKDVAEVV
DNATEARRSA
selected fasta
>putative glycosyltransferase [putative glycosyltransferase]
ATGAGGATTATGTTCACCGCCTCGAACTGGGCGGGACATTACATGTGCATGGTGCCCCTG
GCCTGGGCGCTGCGCGCCGCGGGACACGAGATCCGGGTGGCGTGCCCGCCGTCGCAGGAA
CGCGGGGTCGCCGCGACCGGCCTGATGCCGGTCCCGGTGCTCGACGCGCCGGACATGATG
GAAAGCGCCCGGCTGGCGTTCTATGTGCAGGCCATGTACACACCGCCGCAGTCCGGTCCG
CGGCCGCTGCCGCTGCACCCGTTCACCGGGCAGCCGATGCAGTCGCTCAACGACTTCGAC
GCCGGCGACCTGCGCGACTTCTGGAAGAAGTCGATCGACGCGGTGCAGCGCAGCTATGAC
AACGCGGTGAGCTTCGGCGACCACTGGCGGCCCGACCTGGTGGTGCACGACATCATGGCC
GTCGAGGGCGCACTGGTCGCCGCGCTCCGGGGCGTGCCGAGCGTCTATGTGTCGCCCGGG
TTCATCGGCACCGTGGAGACCGAGCCGGGGCTCGACCTGGTCTCGGCGGACCCGCTGTCG
TGCTTCGAGAAGTACGGCGTCGAGTGGGGCCGCGACCGGATCCAGTACGCGGTGGACCCC
TCACCGGACGTGGCGGTGCCGCCGCTGGGCGACGCGCTGCGGCTGCCCATGCGCTACGTG
CCCTACAACGGCGCCCAGGGCGCGGACCCGTGGCAGCTGGGGCCGATCCGGGGCAGACGC
GTGTGCATCGTCTGGGGCAACTCGGCCTCGGGCATCTTCGGCGCCGACGTACCGGCGCTG
CGGCACGCCATCGACGCGGCGGTGCGGCAGGGCGCGGAGGTGGTGCTCACGGCGCCGCAG
GAACAGGTGGAGGAGCTGGGAGCGCTGCCGGCCGGCGTCCGGGTGCTGCGCAACTGCCCG
CTGGAGCTCATCCTCCCGTACTGCGACCTGCTGGTGCACCACGGCAGCGCCAACTGCTAC
ATGAACGGCATCGTGGCGGGGATTCCGCAGCTGTCCCTCGCCCTCAACTACGACACGCTG
ATCTGCGGCCGCCGTATCGATCCCGCCGGCGCCACCCTGACCCTGTCCGGCCTTGAGGCC
ACGGCCGAGAAGGTCGAGGAGGCGCTGCGCCGGGTGCTGTTCGACCACCGCTACCGCCGG
GCGGCGGAGAAACTGCGGGACGGCGTCGAGCGGGCACCTTCGCCCGCCGCGGTCGCCGGG
CTGCTGACCCGCCTCGTGGCGGACGGCGGGCTGTCGGCGAAGGACGTCGCCGAGGTCGTG
GACAACGCCACCGAGGCTCGGAGGAGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [311-385]  0.0001 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [11-155]  3.1e-08 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [198-294]  5.5e-23 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.883 Signal
Eukaryota   
 [1-23]  0.359 Signal
Bacteria, Gram-positive   
 [1-23]  0.582 Signal
Bacteria, Gram-negative   
TMHMM No significant hit