close all open/close all

CDS information : Avil_00280


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction27,779 / 28,792 / + [in whole cluster]
27,779 / 28,792 / + [in contig]
Location27779..28792 [in whole cluster]
27779..28792 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductUDP-glucuronic acid decarboxylase
Product (GenBank)putative NDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)aviE2
EC number
Keyword
  • 2-O-isobutyryl-L-lyxose
Note
Note (GenBank)
  • AviE2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[16242656] Genes encoding enzymes responsible for biosynthesis of L-lyxose and attachment of eurekanate during avilamycin biosynthesis. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>UDP-glucuronic acid decarboxylase [putative NDP-glucose 4,6-dehydratase]
MTIGLKKGQRAVVTGGAGFIGSHLCERLIERGLSVTCVDNLSTGRIANLDALADEERFTL
LRADVTEPFSVEGPVHHVVHLASPASPLDYLALPLETLRVGSAGTENALRLAVAHGARFV
VASTSEIYGDPAEHPQSESYWGNVNPIGPRSVYDEAKRFTEALTAAYARTLGADTGIARL
FNSYGPRMRRDDGRVVPTFIDQALAGLPLTINGSGAQTRSLCYVEDTVRGLMALMDSSFP
GPVNIGATGEMTVRQIAEAIAALAGVELRTEFRAPAEDEPGRRCPDIETARTKLGWKPEV
PLAEGLKRTLLWWESTYPRDMAHDGVNGSSDIRSGAA
selected fasta
>UDP-glucuronic acid decarboxylase [putative NDP-glucose 4,6-dehydratase]
GTGACAATCGGGCTGAAGAAGGGACAGCGGGCCGTCGTCACCGGGGGTGCCGGCTTCATC
GGCTCCCACCTGTGCGAACGGCTCATCGAGCGGGGTCTGTCGGTGACCTGCGTGGACAAC
CTGTCCACCGGCAGGATCGCGAACCTCGACGCGCTCGCCGACGAGGAGCGGTTCACGCTG
CTGCGGGCCGACGTGACCGAGCCGTTCTCCGTCGAGGGGCCGGTCCACCACGTCGTCCAC
CTGGCGTCGCCGGCCTCCCCCCTGGACTATCTGGCGCTGCCGCTGGAGACGCTGCGGGTC
GGCTCGGCCGGGACCGAGAACGCGCTGCGGCTGGCGGTGGCGCACGGCGCCCGCTTCGTG
GTCGCCTCCACCTCGGAGATCTACGGGGATCCCGCCGAGCACCCGCAGTCCGAGAGCTAC
TGGGGCAACGTCAACCCGATCGGCCCGCGTTCGGTGTACGACGAGGCCAAACGGTTCACC
GAGGCGCTGACCGCCGCCTACGCGCGCACGCTGGGCGCGGACACCGGCATTGCCCGCCTG
TTCAACTCCTACGGACCGCGGATGCGCCGCGACGACGGGCGGGTGGTGCCGACCTTCATC
GACCAGGCGCTCGCCGGACTGCCGCTCACCATCAACGGCAGCGGCGCCCAGACCCGGTCG
CTGTGCTACGTCGAGGACACGGTGCGGGGACTGATGGCCCTGATGGACTCGTCCTTCCCG
GGCCCGGTCAACATCGGCGCGACCGGTGAGATGACCGTCCGTCAGATCGCGGAGGCGATC
GCCGCACTCGCGGGAGTGGAGCTGCGGACCGAGTTCCGCGCGCCGGCGGAGGACGAGCCC
GGCCGGCGCTGCCCCGACATCGAGACCGCCAGGACGAAGCTGGGCTGGAAGCCCGAGGTG
CCGCTCGCCGAAGGGCTCAAGCGCACCCTGCTCTGGTGGGAGAGCACCTACCCGCGGGAC
ATGGCCCACGACGGCGTGAACGGTTCGAGCGACATCAGGAGTGGAGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [12-246]  1.40000000000001e-44 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [7-180]  4.9e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit