close all open/close all

CDS information : Avil_00290


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction28,789 / 29,511 / + [in whole cluster]
28,789 / 29,511 / + [in contig]
Location28789..29511 [in whole cluster]
28789..29511 [in contig]
TypeCDS
Length723 bp (240 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-mannose C-6 O-methyltransferase
Product (GenBank)putative methyltransferase
Gene
Gene (GenBank)aviG2
EC number2.1.1.-
Keyword
  • 2,6-di-O-methyl-D-mannose
Note
Note (GenBank)
  • AviG2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15489167] Novel avilamycin derivatives with improved polarity generated by targeted gene disruption. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>D-mannose C-6 O-methyltransferase [putative methyltransferase]
MTSQTPAGKGVRMPRSVEELNVVWEWDDPEGMQVRLAGYQPRDEYLRDRAERIDQLAAAL
SLTPDTDLFEIGSGEGVMARELAPRVGSLLCADVSLSFLEKTRATCAGRPNVTYHHIRND
YLAGLPDASFDAGFALNVFIHLNAFEVYLYLREIRRVLRPGGRFLFNYLDFGEVTRPQFH
EYVKSYPGAHPVAVKGFMSWLGTDVVRKLAAEAGLTPVPGSHDDQGGVCFLTLRREQEAA
selected fasta
>D-mannose C-6 O-methyltransferase [putative methyltransferase]
ATGACAAGCCAGACACCGGCCGGCAAGGGGGTGCGGATGCCCCGGAGCGTCGAGGAACTC
AACGTGGTCTGGGAGTGGGACGACCCCGAGGGCATGCAGGTGCGGCTCGCGGGCTATCAG
CCCCGTGACGAGTATCTGCGCGACCGTGCCGAGCGGATCGACCAGTTGGCCGCGGCGCTG
TCCCTGACCCCGGACACCGATCTGTTCGAGATCGGCAGCGGCGAGGGCGTCATGGCCCGC
GAGCTGGCGCCCCGGGTCGGCAGCCTGCTGTGCGCGGACGTCAGCCTGTCGTTCCTGGAG
AAGACCCGCGCCACCTGTGCGGGGCGGCCCAACGTCACCTACCACCACATCCGGAACGAC
TACCTGGCCGGACTTCCGGACGCCTCCTTCGACGCCGGATTCGCGCTCAACGTCTTCATC
CACCTGAACGCCTTCGAGGTCTACCTCTACCTGCGCGAGATCCGGCGGGTGCTGCGGCCC
GGCGGCCGGTTCCTCTTCAACTACCTGGACTTCGGCGAGGTCACCAGGCCGCAGTTCCAC
GAGTACGTCAAGAGCTACCCCGGGGCGCACCCGGTCGCCGTCAAGGGATTCATGTCCTGG
CTCGGCACCGACGTGGTCCGCAAGCTCGCGGCGGAGGCCGGGCTGACACCGGTACCCGGG
TCGCACGACGACCAGGGCGGCGTCTGCTTCCTCACCCTGCGCAGGGAACAGGAGGCTGCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [70-166]  1.7e-12 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit