close all open/close all

CDS information : Avil_00300


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction29,508 / 30,500 / + [in whole cluster]
29,508 / 30,500 / + [in contig]
Location29508..30500 [in whole cluster]
29508..30500 [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)aviZ1
EC number
Keyword
Note
Note (GenBank)
  • AviZ1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
P80874
PmId
[15019785] Structural and catalytic diversity in the two family 11 aldo-keto reductases. (J Mol Biol. , 2004)
Family/Domain
FD
IPR023210

close this sectionSequence

selected fasta
>putative oxidoreductase [putative oxidoreductase]
MRYRTLGRQGPEVSSVCLGTWALSGFWGSRTEPAVEAVRRAFDLGVNFFDTAHAYGAGMA
EAGLARGLGDLLRTRRSDIVISTKGGLELRGDGVVRNSDAGFLRANLTDSLRSLGTDYVD
VFLVHWPDPRVPPAETAGALAGFVEEGLARYVGVSNFTVEEMAEFSSVVTPQVAQVPFNM
LDRGIEKQVLPHCAAAGIGVMGWSALAHGVLAGALRPGQVFPPDDWRAYSPTFQGERFAK
LLAAVDRLKEFAAERGHSVAQLALAWVLAHPSGVIPVIGAQLPEHLEDSVRAVDLDLDEA
ELRALDELLADAPELDGSGDQPPAREERSV
selected fasta
>putative oxidoreductase [putative oxidoreductase]
GTGAGGTACCGCACGCTGGGACGGCAAGGCCCCGAGGTCTCCTCCGTCTGCCTGGGCACC
TGGGCGCTGAGCGGGTTCTGGGGCAGCCGGACCGAGCCGGCCGTCGAGGCGGTCCGGCGC
GCGTTCGACCTGGGCGTCAACTTCTTCGACACCGCGCACGCCTACGGCGCGGGCATGGCC
GAGGCGGGACTGGCCCGCGGCCTGGGCGACCTGCTGCGCACCCGTCGCTCCGACATCGTC
ATCTCGACGAAGGGCGGCCTGGAGCTGCGGGGCGACGGTGTGGTCCGCAACAGCGACGCC
GGTTTCCTGCGCGCCAACCTGACCGACAGCCTGCGCTCGCTGGGGACCGACTACGTGGAC
GTGTTCCTGGTCCACTGGCCCGACCCGAGGGTCCCGCCGGCCGAGACGGCGGGTGCGCTG
GCGGGGTTCGTGGAGGAAGGGCTCGCCCGGTACGTGGGCGTCTCCAACTTCACCGTCGAG
GAAATGGCCGAATTCTCCTCCGTCGTCACCCCGCAGGTCGCCCAGGTGCCGTTCAACATG
CTCGACCGCGGCATCGAGAAGCAGGTGCTGCCGCACTGCGCCGCTGCCGGGATCGGCGTC
ATGGGGTGGTCGGCGCTCGCGCACGGGGTGCTGGCGGGAGCGCTCCGTCCCGGCCAGGTG
TTCCCGCCCGACGACTGGCGCGCCTACTCCCCGACCTTCCAGGGCGAACGCTTCGCCAAG
CTGCTCGCGGCCGTGGACCGGCTGAAGGAGTTCGCCGCCGAACGCGGGCACAGTGTCGCC
CAGCTCGCGCTTGCCTGGGTGCTGGCCCACCCCTCGGGAGTCATCCCGGTCATCGGCGCC
CAGCTTCCCGAGCACCTGGAGGACAGCGTCCGGGCCGTGGACCTCGACCTCGACGAGGCC
GAGCTGCGCGCCCTGGACGAACTGCTGGCCGACGCGCCCGAGCTGGACGGCAGCGGGGAC
CAACCGCCCGCGCGCGAAGAGAGGTCGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018170 Aldo/keto reductase, conserved site (Conserved_site)
 [140-157]  PS00062
PS00062   ALDOKETO_REDUCTASE_2
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-314]  1.09999184471405e-96 SSF51430
SSF51430   Aldo/ket_red
 [16-309]  2.20000000000002e-70 PF00248
PF00248   Aldo_ket_red
 [1-309]  4.69999999999992e-93 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
SignalP
 [1-31]  0.801 Signal
Eukaryota   
TMHMM No significant hit