close all open/close all

CDS information : Avil_00310


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction30,514 / 31,233 / + [in whole cluster]
30,514 / 31,233 / + [in contig]
Location30514..31233 [in whole cluster]
30514..31233 [in contig]
TypeCDS
Length720 bp (239 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-mannose C-2 O-methyltransferase
Product (GenBank)putative methyltransferase
Gene
Gene (GenBank)aviG6
EC number2.1.1.-
Keyword
  • 2,6-di-O-methyl-D-mannose
Note
Note (GenBank)
  • AviG6
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15489167] Novel avilamycin derivatives with improved polarity generated by targeted gene disruption. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>D-mannose C-2 O-methyltransferase [putative methyltransferase]
MPVPQLNDWYDQLTVEIIERVCAPDSGCLDIGAGGGEILTHMRRAAPRGRHFAVEPLPQY
AEQLRRDFPEVTVWQAAAAATPGRDSFVHVVSNPGYSGLRRRPYDRADETLEEIAVDTVR
LDDVVPEDARVDLVKVDVEGGEVGALRGAAELLRRQSPVVVFEHGGDHAMRDYGTTSDDL
WALLVDDLGYTLYTLPGWLAAEPGLDRAALAAELRTQWYFVADRGPLSARSPRGEVHST
selected fasta
>D-mannose C-2 O-methyltransferase [putative methyltransferase]
ATGCCCGTCCCCCAGCTCAACGACTGGTACGACCAGTTGACCGTCGAGATCATCGAACGG
GTCTGCGCCCCCGACTCCGGCTGCCTGGACATCGGTGCCGGCGGCGGCGAGATCCTCACG
CACATGCGCCGGGCCGCCCCGCGGGGCCGGCACTTCGCGGTCGAGCCGCTGCCGCAGTAC
GCCGAACAGCTGCGCCGCGACTTCCCCGAGGTCACGGTATGGCAGGCCGCCGCGGCCGCC
ACCCCTGGCCGGGACAGCTTCGTCCACGTGGTCTCCAACCCCGGCTACAGCGGCCTGCGC
CGCCGTCCGTACGACCGCGCCGACGAGACCCTGGAAGAGATCGCGGTGGACACCGTACGT
CTGGACGACGTCGTCCCCGAGGACGCCCGCGTGGACCTGGTCAAGGTGGACGTGGAGGGC
GGCGAGGTGGGCGCCCTGCGCGGGGCGGCCGAGCTGCTGCGCCGGCAGTCCCCCGTGGTG
GTCTTCGAACACGGCGGCGACCACGCGATGCGCGACTACGGCACCACCAGCGACGACCTG
TGGGCGCTGCTGGTCGACGACCTCGGCTACACGCTGTACACCCTGCCGGGCTGGCTGGCG
GCGGAGCCGGGCCTCGACCGGGCCGCTCTCGCCGCCGAGCTGCGCACGCAGTGGTACTTC
GTCGCCGATCGCGGGCCCCTGTCCGCCCGTTCCCCCCGAGGAGAAGTGCATTCGACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006342 Methyltransferase FkbM (Domain)
 [28-164]  9.5e-30 TIGR01444
TIGR01444   FkbM_fam
 [30-192]  9.10000000000001e-22 PF05050
PF05050   Methyltransf_21
SignalP
 [1-28]  0.066 Signal
Eukaryota   
TMHMM No significant hit