close all open/close all

CDS information : Avil_00320


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction31,230 / 32,174 / + [in whole cluster]
31,230 / 32,174 / + [in contig]
Location31230..32174 [in whole cluster]
31230..32174 [in contig]
TypeCDS
Length945 bp (314 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)putative oxygenase
Gene
Gene (GenBank)aviO3
EC number
Keyword
Note
Note (GenBank)
  • AviO3
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15640214] Genes involved in formation and attachment of a two-carbon chain as a component of eurekanate, a branched-chain sugar moiety of avilamycin A. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative oxygenase]
MTDTTAPSLASLAVPECHIRETGLLPEHVTAFRRQGVLAVRGLLSPAELESVQEAAAGLI
DDAWRTRSMHDTIWTLEPHEPDAAPVRIEYVMDKSPVMARLAGHPLLLRAMETLVGPNFI
PTWDSMVFKTTAGAPRLAWHRDGQMYSDAVAVTGGGRVIDVGIYLDHAPEDNCVWAIPQS
NYWEDEQVTETADRLNATEWDATGAVPAVMRPGDALLHNILTLHGAPAVVGKQRRVVYYE
YRPGEVERQLGPHVPEYVGLKQQVLRACLEQRAASGEHRDEEPFEYRPVEQYRLWDESPA
ISGLRFPHEEYWRW
selected fasta
>hypothetical protein [putative oxygenase]
ATGACCGATACAACTGCCCCCTCCCTCGCCTCCCTCGCGGTCCCCGAATGCCATATCCGG
GAGACCGGCCTGCTCCCGGAGCACGTCACCGCCTTCCGGCGGCAGGGTGTGCTGGCCGTG
CGCGGCCTGCTGAGCCCCGCCGAACTGGAGTCGGTGCAGGAGGCGGCGGCCGGCCTGATC
GACGACGCCTGGCGCACCCGGTCCATGCACGACACCATCTGGACGCTGGAGCCCCACGAG
CCCGACGCGGCCCCGGTCCGCATCGAGTACGTCATGGACAAGTCCCCGGTGATGGCCCGG
CTGGCGGGCCATCCGCTGCTGCTGCGCGCCATGGAGACCCTGGTCGGGCCGAACTTCATC
CCCACCTGGGACAGCATGGTGTTCAAGACCACCGCGGGCGCGCCCCGGCTGGCCTGGCAC
CGTGACGGCCAGATGTACTCCGATGCCGTCGCCGTCACCGGCGGCGGTCGCGTCATCGAC
GTGGGCATCTACCTCGACCACGCGCCCGAGGACAACTGTGTCTGGGCCATCCCGCAGTCC
AACTACTGGGAGGACGAGCAGGTCACCGAGACCGCCGACCGGCTCAACGCCACCGAGTGG
GACGCGACCGGGGCCGTCCCCGCCGTGATGCGGCCGGGCGACGCCCTGCTGCACAACATC
CTGACACTGCACGGCGCCCCGGCGGTGGTGGGCAAGCAGCGCAGGGTCGTCTACTACGAG
TACCGGCCCGGCGAGGTGGAGCGTCAGCTCGGCCCGCACGTGCCCGAGTACGTGGGGCTC
AAGCAGCAGGTGCTGCGCGCGTGCCTGGAGCAGCGGGCCGCGTCCGGGGAGCACCGGGAC
GAGGAGCCCTTCGAGTACCGCCCGGTGGAGCAGTACCGGCTCTGGGACGAGTCGCCCGCG
ATCTCCGGCCTGCGGTTCCCGCACGAGGAGTACTGGCGGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [32-235]  2.4e-32 PF05721
PF05721   PhyH
SignalP
 [1-39]  0.09 Signal
Bacteria, Gram-positive   
TMHMM No significant hit