close all open/close all

CDS information : Avil_00330


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction32,171 / 33,004 / + [in whole cluster]
32,171 / 33,004 / + [in contig]
Location32171..33004 [in whole cluster]
32171..33004 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)AviG3
Gene
Gene (GenBank)aviG3
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [AviG3]
MNLLSRLPLLGALAPAPARPGGEPTAQEVIAERFRERTDPRPGDWAYAHLLDLRNALAEQ
LAGASGRWLDFGAGTSPYRDLLPGARLETAEMRGGEDLTADHELDEAGLCGLPDGSFDGV
LSTQVLEHVTDPDLHLREALRLLRPGGRLVLSTHGVWEEHGGQDLWRWTADGLAAQAERA
GFTVDRTVKLTCGPRGLLLLLRYHGREHGWPAGGPVGLLLRTLALADRLRPRLVDDYLDR
VFAGQGRVEGPAEPFYLDILLTASKPREPEKPERDAI
selected fasta
>putative methyltransferase [AviG3]
GTGAACCTGCTGAGCCGCCTGCCGCTGCTGGGCGCGCTCGCCCCGGCGCCGGCGCGCCCG
GGCGGCGAGCCCACCGCCCAGGAGGTCATCGCCGAGCGCTTCCGGGAGCGGACCGATCCG
CGCCCCGGCGACTGGGCCTACGCCCATCTGCTCGACCTCCGCAACGCGCTGGCCGAGCAG
CTCGCCGGGGCGTCGGGGCGCTGGCTCGACTTCGGAGCGGGCACCTCGCCGTACCGCGAC
CTGCTCCCCGGCGCCCGGCTGGAGACGGCCGAGATGCGCGGCGGCGAGGACCTGACGGCG
GATCACGAGCTGGACGAGGCCGGGCTGTGCGGCCTGCCGGACGGCTCGTTCGACGGTGTG
CTCTCCACCCAGGTCCTGGAACACGTGACGGACCCGGACCTGCATCTGCGCGAGGCGCTC
CGGCTGCTGCGGCCGGGCGGCAGGCTGGTGCTGTCCACGCATGGCGTCTGGGAGGAGCAC
GGCGGGCAGGACCTGTGGCGCTGGACCGCCGACGGACTCGCGGCCCAGGCCGAGCGGGCC
GGGTTCACCGTGGACCGAACGGTCAAGCTCACCTGCGGACCGCGCGGTCTGCTGCTCCTG
CTGCGCTACCACGGCCGGGAGCACGGCTGGCCGGCGGGCGGTCCGGTCGGGCTGCTGCTG
CGGACCCTGGCCCTGGCCGACCGGCTGCGCCCGCGCCTCGTCGACGACTACCTCGACCGG
GTCTTCGCCGGCCAAGGCCGCGTCGAGGGCCCGGCCGAGCCGTTCTACCTGGACATCCTG
CTGACCGCCAGCAAGCCGCGCGAGCCGGAGAAGCCGGAGAGGGACGCGATATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [88-151]  1.7e-10 PF08241
PF08241   Methyltransf_11
SignalP
 [1-18]  0.525 Signal
Bacteria, Gram-positive   
 [1-18]  0.974 Signal
Eukaryota   
 [1-20]  0.462 Signal
Bacteria, Gram-negative   
TMHMM No significant hit