close all open/close all

CDS information : Avil_00340


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction33,001 / 34,191 / + [in whole cluster]
33,001 / 34,191 / + [in contig]
Location33001..34191 [in whole cluster]
33001..34191 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-glucose 2-epimerase
Product (GenBank)AviX12
Gene
Gene (GenBank)aviX12
EC number5.1.3.-
Keyword
  • 2,6-di-O-methyl-D-mannose
Note
Note (GenBank)
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[16537546] The active conformation of avilamycin A is conferred by AviX12, a radical AdoMet enzyme. (J Biol Chem. , 2006)

close this sectionSequence

selected fasta
>D-glucose 2-epimerase [AviX12]
MTQPPPSPTMCVLPWIHLCASIDGVYGRCCVDDSMYHNELYESEAEPVFKLNADAVGCAP
NSRYAQDNPDEVRGLTEAFNSPNMRRTRLAMLAGERVSACDYCYHREDRGATSYRQSINE
RFADTVDFADLAERTAPDGSFEEFPFFLDIRFGNTCNLRCVMCAYPVSSGWGAKKRPKWS
SAVIDPYREDEELWATLRENAHLIRRLYFAGGEPFMQPGHFAMLDLLIETGNAENVDIVY
NSNLTVLPEKVFDRFPHFKSVGIGASCDGVGEVFERIRQPAKWDVFVANVRRAKTEVNLW
LQVAPQRLNLWGLRDLLLFAREEGLDADLANVVQWPDDLSVANLPDEEKRRATVELAELA
EWCDGLDWSKPAAHLRALSAFMNAADPSELIAEGGV
selected fasta
>D-glucose 2-epimerase [AviX12]
ATGACCCAGCCCCCGCCCAGTCCCACCATGTGTGTGCTGCCGTGGATCCACCTGTGCGCC
TCCATCGACGGTGTCTACGGCCGCTGCTGTGTGGACGACTCGATGTACCACAACGAGCTG
TACGAATCCGAGGCGGAGCCGGTCTTCAAGCTCAACGCCGACGCTGTCGGCTGCGCGCCC
AACTCCCGCTACGCACAGGACAATCCCGATGAGGTCAGAGGGCTGACCGAGGCGTTCAAC
AGCCCCAACATGCGGCGGACCCGGCTGGCGATGCTGGCCGGCGAGCGCGTGTCCGCGTGC
GACTACTGCTATCACCGCGAGGACCGGGGCGCGACGTCCTACCGGCAGAGCATCAACGAG
CGGTTCGCCGACACGGTGGACTTCGCCGATCTGGCCGAACGTACCGCCCCCGACGGCTCG
TTCGAGGAGTTCCCCTTCTTCCTCGACATCCGGTTCGGCAACACCTGCAACCTGCGGTGC
GTGATGTGCGCCTACCCGGTCAGCTCCGGCTGGGGTGCCAAGAAGCGCCCGAAATGGTCG
TCCGCGGTGATCGACCCGTACCGGGAGGACGAGGAGCTGTGGGCGACGCTGCGCGAGAAC
GCCCACCTCATCCGGCGGCTGTACTTCGCGGGCGGCGAGCCCTTCATGCAGCCCGGCCAC
TTCGCGATGCTGGACCTGCTGATCGAGACCGGCAACGCGGAAAACGTCGACATCGTCTAC
AACTCCAACCTCACGGTGCTGCCGGAGAAGGTCTTCGACCGCTTCCCGCACTTCAAGAGC
GTCGGGATCGGCGCGTCCTGCGACGGCGTCGGCGAGGTCTTCGAGCGCATCCGCCAGCCC
GCGAAGTGGGACGTCTTCGTCGCGAACGTACGCCGTGCCAAGACCGAGGTGAACCTGTGG
CTCCAGGTCGCCCCGCAGCGGCTGAACCTGTGGGGACTGCGGGACCTGCTGCTCTTCGCC
CGCGAGGAGGGCCTCGACGCGGACCTGGCCAATGTCGTGCAGTGGCCCGACGACCTGTCG
GTCGCCAATCTCCCGGACGAGGAGAAGCGACGGGCGACCGTCGAGCTGGCCGAACTCGCC
GAGTGGTGCGACGGCCTGGACTGGAGCAAGCCCGCCGCCCATCTGCGGGCGCTGAGCGCG
TTCATGAACGCCGCTGACCCGTCCGAACTGATCGCCGAAGGAGGAGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007197 Radical SAM (Domain)
 [152-294]  9.40000000000003e-10 PF04055
PF04055   Radical_SAM
IPR013785 Aldolase-type TIM barrel (Domain)
 [150-294]  3e-05 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP
 [1-20]  0.384 Signal
Bacteria, Gram-negative   
 [1-20]  0.494 Signal
Bacteria, Gram-positive   
 [1-27]  0.948 Signal
Eukaryota   
TMHMM No significant hit