close all open/close all

CDS information : Avil_00350


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction34,188 / 35,159 / + [in whole cluster]
34,188 / 35,159 / + [in contig]
Location34188..35159 [in whole cluster]
34188..35159 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productavilamycin resistance ABC transporter ATP-binding protein
Product (GenBank)putative ATP binding protein
Gene
Gene (GenBank)aviABC1
EC number
Keyword
Note
Note (GenBank)
  • AviABC1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)

close this sectionSequence

selected fasta
>avilamycin resistance ABC transporter ATP-binding protein [putative ATP binding protein]
MSGSAKAALVAEGLRKTYGSETALDGFDLVVPEGTVCALLGPNGAGKTTAVRILSTLLKP
DGGRALVAGLDVTREAAEVRRNIGVTGQYPAVEEILTGRENLEMWGRLYHVGRREAQRRT
EELLEQFDLTEAADKRLKHYSGGMRRRLDLAAGFFTVPKVLFLDEPTTGLDPRNRNEVWK
MVRSMVEQGTTVLLTTQYLEEADRLADQISVIDAGRGVVEGTPETLKSLVGGDRIVVTLA
ATEDLSAAAAQVARFTGTEPEVDAEARRIDAPVRDRVGDLVEIVQLLRGQGHGVVDVSLR
RPTLDDVFLHATNRAGRRKEPVG
selected fasta
>avilamycin resistance ABC transporter ATP-binding protein [putative ATP binding protein]
ATGAGCGGGTCGGCGAAAGCTGCCCTGGTTGCCGAGGGGCTGCGCAAGACCTACGGATCC
GAGACGGCGCTGGACGGGTTCGACCTCGTCGTGCCCGAGGGCACCGTGTGCGCCCTGCTC
GGTCCCAACGGCGCGGGCAAGACCACCGCCGTACGCATCCTGAGCACCCTGCTCAAGCCG
GACGGCGGCCGTGCCCTGGTGGCCGGCCTCGATGTGACCCGCGAGGCCGCCGAGGTGCGC
CGGAACATCGGCGTCACCGGCCAGTACCCGGCGGTCGAGGAGATCCTGACCGGCCGCGAG
AACCTGGAGATGTGGGGCCGCCTCTACCACGTGGGCCGCAGGGAGGCGCAGCGCCGTACG
GAAGAACTGCTGGAGCAGTTCGACCTGACCGAGGCCGCCGACAAGCGGCTCAAGCACTAC
TCGGGCGGTATGCGGCGCAGGCTCGACCTGGCCGCCGGATTCTTCACCGTGCCCAAGGTG
CTCTTCCTGGACGAGCCCACCACCGGCCTCGACCCGCGCAACCGCAACGAGGTCTGGAAG
ATGGTCCGTTCGATGGTCGAGCAGGGCACCACCGTGCTGCTCACCACGCAGTACCTGGAG
GAGGCCGACCGGCTCGCCGACCAGATCTCGGTGATCGACGCGGGCCGCGGGGTCGTCGAG
GGCACCCCCGAGACCCTGAAGTCCCTGGTGGGCGGCGACCGGATCGTGGTGACCCTGGCG
GCCACCGAGGACCTGTCGGCCGCCGCGGCTCAGGTCGCCCGCTTCACGGGGACCGAGCCC
GAGGTGGACGCCGAGGCCCGCCGTATCGACGCGCCGGTACGCGACCGGGTCGGCGACCTC
GTGGAGATCGTGCAGCTGCTGCGCGGGCAGGGCCACGGCGTGGTCGATGTGTCGCTGCGC
CGCCCGACGCTGGATGACGTGTTCCTGCACGCGACCAACCGTGCCGGTCGAAGGAAGGAG
CCGGTCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [48-168]  3.8e-17 PF00005
PF00005   ABC_tran
 [9-239]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [33-216]  2.2999993566538e-14 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [16-312]  5.59999999999999e-105 TIGR01188
TIGR01188   DrrA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [140-154]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-19]  0.136 Signal
Eukaryota   
TMHMM No significant hit