close all open/close all

CDS information : Avil_00360


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction35,156 / 35,953 / + [in whole cluster]
35,156 / 35,953 / + [in contig]
Location35156..35953 [in whole cluster]
35156..35953 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productavilamycin resistance ABC transporter permease protein
Product (GenBank)putative transmembrane protein
Gene
Gene (GenBank)aviABC2
EC number
Keyword
Note
Note (GenBank)
  • AviABC2
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)

close this sectionSequence

selected fasta
>avilamycin resistance ABC transporter permease protein [putative transmembrane protein]
MMAVLGRARWAVTDGWVVGRANMINWRRNPGLIFYCMMFPIMTVVFGYVFGSAMSVAGGG
DYREFLMPGLFGQAMMFGVVTSMLAVTSAVSRGVTDRFRSMPMAQSGVALGRSFADMFSS
LIELTILLGCGLLVGWRWHEGPGKALAALGLLLLWRYSLIWVGIYLGLLLPPEAAGAAYV
PLLPLTMLANTFVSPEKMPGWLGTIAEWNPLSSTVSACRELFGNPGVTGGSWVAEHAIEL
AVAWPVLLLVLFVPLSVRRYRTLSR
selected fasta
>avilamycin resistance ABC transporter permease protein [putative transmembrane protein]
ATGATGGCCGTGCTGGGAAGGGCCCGCTGGGCCGTCACCGACGGCTGGGTGGTCGGCCGC
GCCAACATGATCAACTGGCGGCGCAATCCCGGGCTGATCTTCTACTGCATGATGTTCCCG
ATCATGACGGTGGTCTTCGGGTACGTGTTCGGCAGCGCCATGTCCGTGGCGGGCGGCGGT
GACTACCGCGAGTTCCTGATGCCGGGGCTGTTCGGACAGGCGATGATGTTCGGTGTCGTC
ACCAGCATGCTGGCCGTCACCAGCGCGGTCTCCCGGGGCGTGACCGACCGGTTCCGCTCG
ATGCCGATGGCGCAGTCGGGCGTCGCGCTGGGCCGCAGCTTCGCCGACATGTTCAGCTCG
CTGATCGAGCTCACGATCCTCCTCGGCTGCGGACTGCTGGTCGGCTGGCGCTGGCACGAG
GGCCCCGGCAAGGCGCTGGCGGCGCTCGGGCTGCTGCTGCTGTGGCGCTACTCGCTCATC
TGGGTCGGGATCTACCTGGGGCTGCTGCTGCCCCCGGAGGCCGCCGGGGCGGCGTATGTG
CCGCTGCTGCCCTTGACGATGCTGGCGAACACCTTCGTCTCGCCGGAGAAGATGCCCGGC
TGGCTGGGCACCATCGCGGAGTGGAACCCGCTGTCCTCCACGGTGTCCGCCTGCCGGGAG
CTGTTCGGCAATCCGGGCGTCACGGGCGGCTCCTGGGTCGCCGAGCACGCGATCGAGCTG
GCCGTCGCCTGGCCCGTACTGCTGCTGGTGCTCTTCGTGCCGCTGTCGGTGCGCCGCTAC
CGGACGCTCAGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [30-263]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [16-221]  8.49999999999995e-20 PF01061
PF01061   ABC2_membrane
SignalP
 [1-15]  0.469 Signal
Eukaryota   
TMHMM
 [32-54]  Transmembrane (i-o) [69-91]  Transmembrane (o-i) [117-136]  Transmembrane (i-o) [146-168]  Transmembrane (o-i) [175-194]  Transmembrane (i-o) [240-257]  Transmembrane (o-i)
Transmembrane 6