close all open/close all

CDS information : Avil_00370


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction35,950 / 36,954 / + [in whole cluster]
35,950 / 36,954 / + [in contig]
Location35950..36954 [in whole cluster]
35950..36954 [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative 2-oxo acid dehydrogenase E1 component alpha subunit
Product (GenBank)putative pyruvate dehydrogenase
Gene
Gene (GenBank)aviB1
EC number
Keyword
  • eurekanate
  • acetyl group
Note
Note (GenBank)
  • AviB1
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[15640214] Genes involved in formation and attachment of a two-carbon chain as a component of eurekanate, a branched-chain sugar moiety of avilamycin A. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q46142
PmId
[8206840] Biochemical and molecular characterization of the Clostridium magnum acetoin dehydrogenase enzyme system. (J Bacteriol. , 1994)

close this sectionSequence

selected fasta
>putative 2-oxo acid dehydrogenase E1 component alpha subunit [putative pyruvate dehydrogenase]
MTTEEGKPAMSAEPRAVRLYRTMRLIREFEERCLAMSLSGEIVGGIHPYIGQEAVAAGVC
AALTDDDVVTSTHRGHGHVLAKGADPKRMLAELCGTTAGLNRGRGGSMHAADVSLGVYGA
NGIVGAGAPIAAGAAWSFQRRGDGRVAVAFFGDGALSQGVVLEAFNLAALWRLPVVFVCE
NNGYATSLPLDRALAGDPVERAAGFGLTARAVDGMDADAVADAAAEAVERCRRGGGPTFL
DCRTYRFNGHHSFEEQVGLNYRDDAEVGEWRARDPLRTQSTRVDGATAGAIDAETSTLID
EAVEFARAGRAPDPAEALHHLYADGTTPRPGVMI
selected fasta
>putative 2-oxo acid dehydrogenase E1 component alpha subunit [putative pyruvate dehydrogenase]
ATGACCACGGAAGAAGGGAAACCGGCGATGAGCGCCGAACCGCGTGCCGTCCGGCTCTAC
CGGACCATGCGCCTGATCAGGGAATTCGAAGAACGCTGCCTGGCGATGTCGCTGTCCGGG
GAGATCGTCGGCGGCATCCACCCCTACATCGGCCAGGAGGCGGTGGCCGCCGGGGTCTGC
GCGGCGCTCACCGACGACGACGTCGTCACCAGCACCCATCGCGGCCATGGCCACGTCCTC
GCCAAGGGAGCCGACCCGAAGCGGATGCTGGCCGAGCTGTGCGGCACGACCGCCGGCCTG
AACCGGGGCCGCGGCGGCTCGATGCACGCCGCCGACGTCAGCCTCGGCGTCTATGGCGCC
AACGGCATCGTGGGGGCGGGCGCCCCCATCGCCGCCGGTGCGGCCTGGTCGTTCCAGCGG
CGCGGTGACGGCCGGGTGGCGGTGGCCTTCTTCGGCGACGGTGCGCTCAGCCAGGGCGTG
GTGCTGGAGGCGTTCAACCTGGCGGCCCTGTGGCGGCTGCCGGTGGTGTTCGTCTGCGAG
AACAACGGCTACGCGACCAGCCTGCCGCTGGACCGGGCGCTGGCCGGCGACCCGGTGGAG
AGGGCGGCCGGGTTCGGCCTGACGGCGCGCGCGGTGGACGGAATGGACGCCGACGCCGTC
GCCGACGCGGCCGCCGAGGCCGTCGAACGCTGCCGCCGGGGCGGCGGTCCCACCTTCCTG
GACTGCCGCACCTACCGGTTCAACGGCCACCACTCCTTCGAGGAGCAGGTGGGGCTGAAC
TACCGGGACGACGCCGAGGTCGGCGAGTGGCGTGCGCGTGACCCGCTGCGCACCCAGAGC
ACCCGCGTGGACGGTGCGACGGCCGGCGCCATCGACGCCGAGACCAGCACGCTGATCGAC
GAGGCCGTGGAGTTCGCCCGCGCGGGCCGGGCCCCCGACCCCGCCGAGGCGCTGCACCAC
CTTTATGCCGACGGCACGACCCCACGGCCCGGAGTGATGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001017 Dehydrogenase, E1 component (Domain)
 [22-306]  2.90000000000003e-70 PF00676
PF00676   E1_dh
SignalP No significant hit
TMHMM No significant hit