close all open/close all

CDS information : Avil_00390


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction37,955 / 38,971 / + [in whole cluster]
37,955 / 38,971 / + [in contig]
Location37955..38971 [in whole cluster]
37955..38971 [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)aviGT3
EC number
Keyword
Note
Note (GenBank)
  • AviGT3
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9RN50
PmId
[15294902] Inactivation of the mycobacterial rhamnosyltransferase, which is needed for the formation of the arabinogalactan-peptidoglycan linker, leads to irreversible loss of viability. (J Biol Chem. , 2004)
Family/Domain
FD
IPR001173

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative glycosyltransferase]
MNSERRPRVVTITVGTNELCWLDRCLGSLLDSDTTGFDLEVCYVDNDSADGSVEHVRATW
PAVTIIRNDRNLGFAGANNVGIRRALESGADYVFLVNPDTWTPPDLVRGLTELAEEWPEY
GIVGPLQYRYDPDSTALDEFNEWTHTALWLGEQHAFAGDGIAHPSPAGLPKGRAPRTLEH
AYVQGSALFARTAMLREIGLLDEVLHTYYEETDLCRRARWAGWRVALHLDLGIQHRGGGG
ATVASTYSRVHMRRNRYYYLFTDVDWHPAKAARLAGRWLVADLMGRSVVGRVPAATGARE
TIEALRWLADRVPTMRSRRRDHRALRARGGRGAAKGAS
selected fasta
>putative glycosyltransferase [putative glycosyltransferase]
ATGAATTCCGAGCGTCGGCCGCGGGTCGTGACGATCACCGTCGGGACCAACGAGCTGTGC
TGGCTGGACCGGTGTCTCGGCTCCTTGCTGGACAGCGACACCACCGGCTTCGACCTGGAG
GTCTGCTACGTCGACAACGACTCGGCGGACGGCAGTGTCGAGCATGTGCGCGCGACCTGG
CCCGCGGTGACGATCATCCGCAACGACCGCAATCTGGGCTTCGCCGGGGCGAACAACGTC
GGCATCCGCCGCGCCCTGGAGTCCGGCGCGGACTACGTGTTCCTCGTCAACCCCGACACC
TGGACGCCGCCCGACCTGGTGCGCGGACTCACCGAACTGGCCGAGGAATGGCCGGAGTAC
GGCATCGTCGGCCCGCTGCAGTACCGCTACGACCCCGACTCCACGGCGCTCGACGAGTTC
AACGAGTGGACGCACACGGCCCTGTGGCTGGGCGAGCAGCACGCCTTCGCCGGCGACGGG
ATCGCCCATCCCTCCCCGGCGGGGCTGCCGAAGGGGCGGGCCCCACGGACGCTGGAGCAC
GCCTATGTGCAGGGTTCGGCGCTCTTCGCCCGGACCGCGATGCTGCGCGAGATCGGGCTG
CTCGACGAGGTGCTGCACACCTACTACGAGGAGACCGACCTGTGCCGCCGGGCCCGCTGG
GCGGGCTGGCGGGTGGCCCTGCACCTGGACCTGGGCATCCAGCACCGGGGCGGCGGCGGG
GCGACCGTGGCCAGCACGTACAGCCGGGTCCACATGCGGCGCAACCGCTACTACTACCTC
TTCACCGACGTCGACTGGCACCCGGCGAAGGCCGCCCGGCTCGCCGGGCGCTGGCTCGTG
GCGGACCTCATGGGCCGCAGCGTCGTCGGCCGCGTCCCGGCCGCGACCGGAGCGCGGGAG
ACCATCGAGGCGCTGCGCTGGCTCGCCGACCGGGTGCCGACCATGCGGTCCCGCCGCCGG
GACCACCGCGCGCTGCGCGCTCGCGGCGGGCGCGGCGCGGCGAAGGGGGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001173 Glycosyl transferase, family 2 (Domain)
 [17-136]  4.10000000000001e-17 PF00535
PF00535   Glycos_transf_2
SignalP
 [1-27]  0.268 Signal
Eukaryota   
TMHMM No significant hit