close all open/close all

CDS information : Avil_00400


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction38,971 / 39,999 / + [in whole cluster]
38,971 / 39,999 / + [in contig]
Location38971..39999 [in whole cluster]
38971..39999 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)aviGT4
EC number
Keyword
  • eurekanate
Note
Note (GenBank)
  • AviGT4
Reference
ACC
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
[16242656] Genes encoding enzymes responsible for biosynthesis of L-lyxose and attachment of eurekanate during avilamycin biosynthesis. (Chem Biol. , 2005)
[17113996] Insights into the synthesis of lipopolysaccharide and antibiotics through the structures of two retaining glycosyltransferases from family GT4. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>glycosyltransferase [putative glycosyltransferase]
MRPLKVALVNIPLRVPGSDAWISVPPQGYGGIQWVVANLMDGLLELGHEVFLLGAPGSPA
GRPGLTVVPAGEPEEIERWLRTADVDVVHDHSGGVIGPAGLPPGTAFISSHHFTTRPVNP
VGCTYSSRAQRAHCGGGDDAPVIPIPVDPARYRSAADQVAKEDFLLFMGRVSPHKGALEA
AAFAHACGRRLVLAGPAWEPEYFDEITRRYGSTVEPIGEVGGERRLDLLASAHAVLAMSQ
AVTGPWGGIWCEPGATVVSEAAVSGTPVVGTGNGCLAEIVPSVGEVVGYGTDFAPDEARR
TLAGLPASDEVRRAAVRLWGHVTIAERYVEQYRRLLAGATWK
selected fasta
>glycosyltransferase [putative glycosyltransferase]
ATGAGGCCGTTGAAGGTGGCGCTGGTCAACATCCCGCTGCGGGTCCCGGGGAGCGATGCC
TGGATCTCCGTACCCCCACAGGGATACGGCGGCATCCAGTGGGTCGTCGCCAACCTGATG
GACGGGCTGCTGGAACTCGGCCACGAGGTCTTCCTGCTGGGTGCCCCGGGCAGCCCGGCC
GGACGCCCGGGGCTGACCGTCGTGCCGGCGGGCGAGCCGGAGGAGATCGAGCGGTGGCTG
CGGACCGCGGACGTCGACGTGGTCCACGACCACAGCGGCGGTGTCATCGGCCCGGCCGGG
CTGCCGCCGGGCACCGCCTTCATCAGCTCGCACCACTTCACCACCCGGCCGGTCAACCCC
GTGGGCTGTACCTACAGTTCCCGGGCGCAGCGCGCCCACTGCGGGGGCGGCGACGACGCG
CCCGTGATCCCGATCCCGGTCGACCCGGCGCGCTACCGGTCCGCCGCGGACCAGGTGGCC
AAGGAGGACTTCCTGCTCTTCATGGGGCGGGTCTCGCCGCACAAGGGGGCGCTGGAGGCG
GCCGCGTTCGCGCACGCCTGCGGCCGGCGCCTGGTGCTGGCCGGGCCCGCCTGGGAGCCG
GAGTACTTCGACGAGATCACTCGCCGGTACGGCTCGACCGTCGAGCCGATCGGTGAGGTG
GGCGGCGAGCGGCGGCTCGACCTGCTCGCCTCCGCACACGCGGTGCTGGCCATGTCCCAG
GCGGTCACCGGGCCGTGGGGCGGCATCTGGTGCGAGCCGGGTGCGACGGTGGTCTCCGAG
GCCGCCGTGAGCGGCACTCCCGTCGTGGGCACGGGCAACGGCTGCCTGGCCGAGATCGTG
CCCTCGGTCGGCGAAGTCGTGGGATACGGCACCGACTTCGCGCCCGACGAAGCACGCCGG
ACCCTGGCAGGGCTGCCGGCATCCGACGAGGTCCGGCGTGCGGCGGTCCGGTTGTGGGGC
CATGTGACGATCGCCGAACGGTATGTGGAGCAGTACCGCAGGCTGCTGGCCGGAGCGACC
TGGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001296 Glycosyl transferase, family 1 (Domain)
 [159-282]  3.9e-07 PF00534
PF00534   Glycos_transf_1
SignalP
 [1-20]  0.408 Signal
Eukaryota   
TMHMM No significant hit