close all open/close all

CDS information : Avil_00420


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction41,022 / 41,720 / + [in whole cluster]
41,022 / 41,720 / + [in contig]
Location41022..41720 [in whole cluster]
41022..41720 [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneaviP
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein
MDVGGVIYYDEPFELAWLQGTFDLAVTADPSVTLRDFIEDTERFYLDGKTPAERPGILSS
AAADESWVRVRRAWRELAQEIPGSIAAVTALAREMPTTVVANQPPECADVLAEWGLTAVL
ETVVLDCFEGVAKPDPRLLGIALARLGRPPGELLVVGNRVDHDVAPARSLGCPAVFVLPE
DGYRRPPGVHPDLTRAYRALRAVRTVPPGDDVPRVASLADLAASPLARLGAL
selected fasta
>hypothetical protein
TTGGATGTCGGAGGCGTCATCTACTACGACGAGCCTTTCGAACTGGCTTGGCTTCAGGGG
ACCTTCGACCTTGCGGTCACCGCTGATCCGAGTGTTACCCTCCGCGATTTCATCGAGGAC
ACCGAGCGTTTCTATCTGGACGGGAAAACGCCGGCGGAGCGACCGGGCATTCTCTCTTCG
GCAGCGGCCGACGAGAGCTGGGTCCGGGTTCGACGGGCCTGGCGGGAACTGGCCCAGGAG
ATTCCTGGTTCGATTGCGGCGGTCACGGCCCTCGCCCGCGAAATGCCGACGACGGTGGTC
GCGAATCAGCCGCCCGAGTGCGCCGACGTACTCGCGGAATGGGGGCTGACCGCCGTCCTG
GAGACGGTGGTCCTCGACTGCTTCGAAGGGGTCGCCAAGCCCGATCCCCGGCTGCTGGGC
ATCGCCCTGGCCCGGCTCGGCCGGCCCCCCGGCGAGCTGCTGGTGGTGGGCAACCGCGTC
GACCACGACGTGGCACCCGCCCGTTCCCTGGGCTGCCCGGCGGTGTTCGTACTGCCGGAG
GACGGCTACCGCAGGCCACCGGGCGTCCATCCGGACCTCACCCGGGCCTACCGCGCCCTG
CGCGCGGTCCGTACCGTGCCTCCGGGGGACGACGTGCCGCGGGTCGCCTCCCTCGCCGAC
CTGGCCGCGTCGCCCCTGGCGCGCCTCGGTGCGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023214 HAD-like domain (Domain)
 [65-181]  2.6e-18 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   no description
 [2-187]  1.1e-17 SSF56784
SSF56784   HAD-like
SignalP No significant hit
TMHMM No significant hit