close all open/close all

CDS information : Avil_00430


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction41,717 / 42,649 / + [in whole cluster]
41,717 / 42,649 / + [in contig]
Location41717..42649 [in whole cluster]
41717..42649 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NAD-dependent epimerase/dehydratase family protein
Product (GenBank)
GeneaviQ3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Family/Domain
FD
IPR001509

close this sectionSequence

selected fasta
>putative NAD-dependent epimerase/dehydratase family protein
MTTADLLPGDRTAVIGATGFIGSRLTARLTADGPRAPAAFNRAFPPVVGGRAAPGLAEAD
IVYFLAAGLSPVLAERRPDLVEAERRLLVEVLEALSRAGHRPVFVLASSGGAVYAPEVEP
PYRETSPTRPDSVYGHAKLRLERELCRHSDAVRAVVARLSNVYGPGQRALRGFGVLPHWL
TAAARGEPVRVFGDPHVVRDYVHVDDVTRFLLALRGRVGGGRLPAVVNVGSGVPTSLSGL
LEIVSGVTGGSVAVRWERGRSFDRQGNWLDVARARAELDWRAAIPLTEGVRQCWERVLHD
AGRAPSASTR
selected fasta
>putative NAD-dependent epimerase/dehydratase family protein
GTGACCACGGCGGACCTGCTGCCCGGGGACCGTACGGCGGTGATCGGGGCGACGGGTTTC
ATCGGATCCCGGCTGACGGCCAGGCTCACCGCTGACGGCCCGCGCGCGCCGGCCGCCTTC
AACCGGGCGTTCCCGCCGGTGGTCGGCGGCCGGGCCGCCCCGGGACTGGCGGAGGCCGAC
ATCGTCTACTTCCTGGCCGCCGGCCTCAGTCCGGTCCTCGCCGAACGTCGGCCCGACCTG
GTCGAGGCCGAACGCCGACTGCTGGTCGAGGTGCTGGAGGCGCTGTCCAGAGCGGGACAC
CGCCCGGTGTTCGTACTGGCCAGCTCGGGCGGGGCGGTCTACGCGCCCGAGGTCGAACCG
CCGTACCGGGAGACCAGCCCGACCCGGCCCGACTCCGTCTACGGGCACGCCAAGCTCCGC
CTCGAACGCGAGCTGTGCCGGCACTCGGATGCCGTCCGTGCCGTGGTCGCGCGGTTGAGC
AATGTCTACGGTCCCGGCCAGCGCGCCCTGCGCGGGTTCGGTGTGCTGCCGCACTGGCTG
ACGGCGGCCGCCCGGGGCGAGCCCGTGCGGGTGTTCGGCGATCCGCATGTGGTCCGGGAC
TATGTCCACGTCGACGACGTCACCCGGTTCCTGCTCGCGCTGCGCGGCCGGGTCGGCGGC
GGCCGGCTGCCCGCCGTGGTGAACGTCGGCTCGGGCGTGCCCACTTCGCTGAGCGGCCTG
CTGGAGATCGTGTCCGGTGTGACCGGCGGCTCCGTCGCGGTGCGCTGGGAGCGGGGACGG
TCCTTCGACCGGCAGGGCAACTGGCTGGATGTCGCACGGGCCCGCGCCGAACTCGACTGG
CGGGCCGCCATCCCCCTGACCGAGGGTGTCCGGCAGTGCTGGGAGCGTGTGCTCCACGAC
GCCGGCCGGGCCCCTTCCGCCTCGACGCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [14-215]  1.4e-30 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [13-183]  7.6e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit