close all open/close all

CDS information : Avil_00440


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction44,218 / 42,761 / - [in whole cluster]
44,218 / 42,761 / - [in contig]
Locationcomplement(42761..44218) [in whole cluster]
complement(42761..44218) [in contig]
TypeCDS
Length1,458 bp (485 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Producthalogenase
Product (GenBank)
GeneaviH
Gene (GenBank)
EC number
Keyword
  • dichloroisoeverninic acid
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>halogenase
MSKKVLVIGGGPAGSTAASLLSKAGMSVKLLERETFPRYHIGESIASSCRTIIDLVGALE
EVDSRGYTVKNGVLLRWGKEDWAIDWPKIFGPDVRSWQVDRDDFDHVLLKNAVKQGADVT
EGVTVKRVLFDGDRAAGAEWLDPDTGELVSEEFDYVIDASGRAGVISKHLKNRRPHEIFR
NVAIWGYWQGGSLLPSSPTGGINVISAPDGWYWVIPLRGDRYSVGFVCHQDRFLERRREH
ADLEAMLASLVEESPTVRDLMANGVYQPGVRVEQDFSYVADSFHGPGYYLAGDAACFLDP
LLSTGVHLALYSGMLAATSVLATVNKDVTEEEAGAFYESLYRNAYQRLFTLVSGVYQQQA
GKAAYFELADAMTPERATAEYEQVDGAVAFAELVAGLADIHDAVTGTHEDRAQQAHAQAD
ALPEDNSVRQLLAAAENARLMAAAGMPAAPVSEAPGKMDAHDLYDPATGLYLVTSPTLGI
GRSRP
selected fasta
>halogenase
ATGTCCAAAAAAGTGCTCGTGATCGGCGGTGGGCCGGCGGGATCCACGGCGGCCTCCTTG
CTCAGCAAGGCCGGCATGTCCGTGAAGCTATTGGAACGGGAGACCTTCCCGCGCTACCAC
ATCGGCGAGTCGATCGCCTCCTCGTGCCGCACCATCATCGACCTCGTCGGCGCGCTGGAG
GAGGTCGACTCCCGCGGTTACACGGTCAAGAACGGCGTGCTGCTGCGCTGGGGCAAGGAG
GACTGGGCGATCGACTGGCCGAAGATCTTCGGTCCCGACGTCCGCTCCTGGCAGGTCGAC
CGCGACGACTTCGACCACGTGCTCCTGAAGAACGCGGTCAAGCAGGGCGCCGACGTCACC
GAGGGCGTCACGGTCAAGCGCGTGCTGTTCGACGGCGACCGCGCGGCTGGGGCGGAGTGG
CTGGACCCCGACACCGGTGAGCTGGTCAGCGAGGAGTTCGACTACGTCATCGACGCCTCG
GGCCGGGCCGGCGTCATCTCCAAGCACCTGAAGAACCGCCGCCCGCACGAGATCTTCCGC
AACGTCGCGATCTGGGGCTACTGGCAGGGCGGCTCGCTGCTGCCCAGTTCGCCCACAGGG
GGCATCAACGTCATCAGCGCCCCGGACGGCTGGTACTGGGTGATCCCGCTGCGCGGGGAC
CGGTACAGCGTCGGTTTCGTCTGCCACCAGGACCGGTTCCTGGAGCGCCGCCGGGAACAC
GCCGACCTGGAGGCGATGCTGGCCTCGCTGGTCGAGGAATCCCCGACCGTGCGCGACCTC
ATGGCGAACGGCGTCTACCAGCCGGGCGTACGGGTGGAGCAGGACTTCTCCTACGTCGCC
GACAGCTTCCACGGCCCCGGCTACTACCTCGCCGGCGACGCCGCCTGCTTCCTCGACCCG
CTGCTGTCCACCGGCGTCCACCTGGCGCTCTACAGCGGCATGCTGGCCGCGACGTCCGTG
CTCGCCACGGTGAACAAGGACGTCACGGAGGAGGAGGCCGGGGCGTTCTACGAGTCGCTC
TACCGCAACGCCTACCAGCGGCTGTTCACCCTGGTGTCCGGCGTGTACCAGCAACAGGCC
GGCAAGGCCGCCTACTTCGAGCTGGCCGACGCGATGACCCCGGAGCGCGCCACGGCCGAG
TACGAGCAGGTCGACGGCGCGGTGGCCTTCGCCGAACTGGTCGCGGGACTGGCCGACATC
CACGACGCCGTCACCGGCACGCACGAGGACCGCGCCCAGCAGGCGCACGCCCAGGCCGAC
GCCCTGCCGGAGGACAACTCCGTCCGCCAGTTGCTCGCGGCGGCCGAGAACGCCCGTTTG
ATGGCGGCGGCCGGGATGCCCGCCGCACCGGTCAGCGAGGCTCCCGGCAAGATGGACGCC
CACGACCTCTACGACCCCGCCACGGGTCTCTACCTGGTGACCAGCCCGACGCTGGGAATC
GGCCGGTCCAGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [4-26]  1.1e-09 PR00420 [152-167]  1.1e-09 PR00420 [285-300]  1.1e-09 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [4-81]  4.5e-12 PF04820 [96-365]  7.1e-22 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit