close all open/close all

CDS information : Avil_00450


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction44,731 / 45,273 / + [in whole cluster]
44,731 / 45,273 / + [in contig]
Location44731..45273 [in whole cluster]
44731..45273 [in contig]
TypeCDS
Length543 bp (180 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneaviX13
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein
MTKRPEETEDYGWHIDASFLAEDADADRDWSGELDVIPPDYDKIFRYNVWSRGRALLLLL
LFSDTGEEDAPTLIRAGSHLDVPPLLEPYGAEGTYLEAGEVGRDRPLRSATGKAGDAYLC
HPFLVHTPVANTGTRPRFMAQPNLLPVGQLELDRPDGRYTPVEQAVRRGLGKDIPRREGR
selected fasta
>hypothetical protein
GTGACGAAGCGGCCCGAGGAGACCGAGGACTACGGCTGGCACATCGACGCCAGCTTCCTG
GCCGAGGACGCGGACGCCGACCGGGACTGGTCCGGTGAGCTGGACGTGATCCCGCCGGAC
TACGACAAGATCTTCCGCTACAACGTGTGGTCCCGCGGCCGGGCGCTGCTGCTCCTGCTC
CTGTTCTCGGACACCGGCGAGGAGGACGCGCCCACGCTGATCCGCGCCGGCTCCCACCTG
GACGTGCCGCCGCTGCTGGAGCCGTATGGCGCGGAGGGCACCTACCTGGAGGCCGGGGAG
GTGGGACGGGACCGGCCGCTCAGGTCGGCCACGGGGAAGGCCGGGGACGCCTATCTGTGC
CACCCCTTCCTGGTGCACACGCCGGTGGCCAACACCGGCACCCGCCCGCGCTTCATGGCC
CAGCCGAACCTGCTGCCCGTGGGGCAGCTCGAACTCGACCGGCCCGACGGGCGGTACACC
CCGGTCGAGCAGGCAGTGCGCCGGGGCCTGGGCAAGGACATACCGCGACGAGAGGGCCGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [38-138]  5.8e-05 PF05721
PF05721   PhyH
SignalP No significant hit
TMHMM No significant hit