close all open/close all

CDS information : Avil_00460


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction45,278 / 46,327 / + [in whole cluster]
45,278 / 46,327 / + [in contig]
Location45278..46327 [in whole cluster]
45278..46327 [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductO-methyltransferase
Product (GenBank)
GeneaviG4
Gene (GenBank)
EC number2.1.1.-
Keyword
  • dichloroisoeverninic acid
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q8KND2
NITE
Calm_00650
PmId
[18561189] Structural characterization of CalO2: a putative orsellinic acid P450 oxidase in the calicheamicin biosynthetic pathway. (Proteins. , 2009)

close this sectionSequence

selected fasta
>O-methyltransferase
MAEKQAVAPPWTDLIRLVFGGMATQVVGLAVRLRLPDAIGEGERTADGLAADFESEPAAM
NRLLRGLAALGVLRESKPGVFALTPVGELRRADRSPSFHSLARMLTDPAVATAWQHLDHS
VRTGGPAFDHVFGRDFFAYLADDPDLSWLYNAAMSQGTGGIAGLVAAHQDFSGVRTVVDV
GGGDGTLLAAVLRAHPSLRGVLYDSAAGVAQAGEVLAAAGVADRAVEAGDFFAAVPEGGD
LYLLKSVVHGWEDERAARILAHCRRALPAHGRIVMVEHLLPDTVPADAVPTTYLNDLNLL
VNGNGLERTRGDFEQLCAAAGLTVEAVTPLAGTDLWLIEAVPASADPLG
selected fasta
>O-methyltransferase
ATGGCGGAGAAGCAGGCCGTGGCGCCCCCCTGGACGGACCTGATCCGGCTGGTGTTCGGC
GGAATGGCCACCCAGGTCGTGGGCCTGGCGGTGCGGCTGCGGCTGCCCGACGCGATCGGG
GAGGGCGAACGGACCGCCGACGGGCTGGCCGCCGACTTCGAGAGCGAACCCGCTGCCATG
AACCGGCTGTTGCGCGGCCTGGCCGCGCTCGGAGTGCTGCGCGAGTCCAAGCCCGGCGTG
TTCGCCCTGACACCGGTCGGGGAACTGCGTCGCGCCGACCGCTCGCCGTCCTTCCACTCA
CTGGCCCGGATGCTCACCGATCCCGCGGTCGCGACGGCCTGGCAGCACCTGGACCACAGC
GTCCGCACCGGCGGCCCGGCCTTCGACCACGTCTTCGGCCGGGACTTCTTCGCGTACCTG
GCGGACGACCCCGACCTGTCGTGGCTCTACAACGCGGCGATGAGCCAGGGCACCGGTGGG
ATCGCCGGCCTGGTCGCGGCGCACCAGGACTTCTCCGGCGTCCGCACCGTGGTGGACGTC
GGGGGCGGGGACGGGACGCTGCTGGCCGCGGTGCTGCGCGCGCACCCCTCGCTGCGCGGC
GTGCTGTACGACTCGGCGGCCGGGGTCGCGCAGGCCGGGGAGGTGCTGGCGGCGGCGGGC
GTCGCGGACCGCGCGGTGGAGGCCGGCGACTTCTTCGCCGCCGTACCCGAGGGCGGTGAC
CTCTACCTGCTCAAGAGCGTCGTCCATGGCTGGGAGGACGAGCGGGCCGCGAGGATTCTG
GCGCACTGCCGCCGGGCACTGCCGGCGCACGGCCGGATCGTCATGGTCGAGCACCTGCTG
CCCGACACGGTGCCCGCGGACGCCGTGCCGACGACCTACCTCAACGACCTCAACCTGCTG
GTCAACGGCAACGGGCTGGAGCGCACGCGTGGCGACTTCGAACAGCTCTGCGCGGCGGCG
GGCCTGACGGTCGAAGCGGTCACGCCGCTGGCCGGAACCGACCTGTGGCTGATCGAGGCC
GTGCCCGCTTCGGCTGACCCGCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [79-317]  7.4e-61 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [12-87]  8.1e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit