close all open/close all

CDS information : Avil_00475


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction46,609 / 47,556 / + [in whole cluster]
46,609 / 47,556 / + [in contig]
Location46609..47556 [in whole cluster]
46609..47556 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-mannose 4,6-dehydratase
putative GDP-D-mannose dehydratase
Product (GenBank)
GeneaviE3
gmd
Gene (GenBank)
EC number4.2.1.47
Keyword
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9L4X4
NITE
Nysta_00040
PmId
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative GDP-mannose 4,6-dehydratase
MVRGQGRPYARDGRPLHPDIRVVSGDLLDQTSLIAAVEQSCPTEIYNLGALSFVPVSWKQ
PTVAAEVTGKGVLRMLEAIRITAGLSSSRTTSSGVPRFYQASTSEMFGKVRESPQSEATP
FHPRSPYGVAKAFGHYMVQNYRESYGMFAVSGILFNHESPIRGPEFVTRKVSLGVAAVKL
GLMDKLRLGNLEAERDWGFAGDYVRGMTMMLAQDEPEDLVLGTGITHRVRDLVDFAFAHV
GLDWRDHVEVDSRLLRPAEVELLCADLSRARQKLGWKPEVSFEELVAMMVDSDLRLLTDS
EDAAGEAVLEQAGLW
selected fasta
>putative GDP-mannose 4,6-dehydratase
ATGGTGCGCGGGCAGGGCCGGCCGTATGCCCGCGACGGTCGGCCCCTGCACCCGGACATC
CGAGTGGTGAGCGGCGACTTGCTGGACCAGACGAGCCTGATCGCTGCTGTCGAGCAGTCC
TGCCCCACCGAGATCTACAACCTCGGCGCCCTGTCGTTCGTCCCGGTCTCCTGGAAGCAG
CCCACCGTTGCCGCGGAGGTGACCGGCAAGGGTGTGCTGCGGATGCTGGAGGCCATCCGC
ATCACGGCGGGGCTCAGCAGTTCCCGGACCACCAGCAGCGGCGTCCCGCGCTTCTATCAG
GCCTCCACCTCGGAGATGTTCGGAAAGGTGCGGGAGTCCCCGCAGAGCGAGGCCACGCCC
TTCCACCCGCGCAGCCCCTACGGGGTGGCCAAGGCGTTCGGGCACTACATGGTGCAGAAC
TACCGCGAGTCGTACGGGATGTTCGCGGTCAGCGGGATCCTGTTCAACCACGAGTCACCG
ATCCGGGGCCCGGAGTTCGTCACGCGCAAGGTGTCGCTCGGGGTGGCCGCCGTGAAGCTG
GGCCTGATGGACAAGCTCCGGCTGGGCAACCTGGAGGCGGAACGCGACTGGGGCTTCGCA
GGGGACTACGTGCGCGGCATGACGATGATGCTCGCCCAGGACGAGCCGGAGGACCTCGTC
CTCGGCACCGGGATCACCCACCGGGTGCGCGATCTGGTGGATTTCGCCTTCGCGCACGTC
GGGCTGGACTGGCGCGACCACGTGGAGGTGGACTCCCGGCTGCTGCGCCCGGCGGAGGTG
GAACTGCTCTGCGCCGACCTGAGCCGCGCTCGGCAGAAGCTCGGCTGGAAGCCCGAGGTC
TCGTTCGAGGAACTGGTCGCCATGATGGTCGACAGCGACCTGCGCCTGCTCACCGACAGT
GAGGACGCCGCCGGCGAGGCCGTTCTCGAACAGGCCGGTCTGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [19-222]  2.1e-46 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [16-161]  9.9e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit