close all open/close all

CDS information : Avil_00480


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction47,550 / 48,956 / + [in whole cluster]
47,550 / 48,956 / + [in contig]
Location47550..48956 [in whole cluster]
47550..48956 [in contig]
TypeCDS
Length1,407 bp (468 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)
GeneaviS
Gene (GenBank)
EC number
Keyword
  • D-olivose
  • 2-deoxy-D-evalose
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9ZA32
NITE
Grana_00210
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase
MVSLPAGQVGGLARARALPSEAYLSDVAGAEFIDWFARCSAAAQCRVTRAPLTELRRWRF
DADTGNLAHESGAFFAVEGLRVRTSYGPVPEWSQPIINQPEIGILGMLVKEVDGVPHCLV
QAKIEPGNHNRIQLSPTVQATRSNYTRIHQGRSTRYLEFFTKAGAGRTLVDVLQSEQGAW
FLRKRNRNMVVQVAEDVPAAKGYHWLPLTELRRLLRIDGLVNMDTRTVLACLPADTFPAS
RPVPVGDVGAALVLSSTGQGTSLNDMGAVLRWFTEAKSRHQLTAHRTPLRDLPGWRGTPE
QITHEDGRHFSIIGVTAQVGDREVAEWDQPLLFPQGRGVVAFVIKVIEGVAHLLVHARFQ
PGLLDGMEMGPTVQCVPENYPQGPPRFLDYVLTASPERLLYSAVLAEEGGRFYHSQNSYL
LVEADDDFPVAVPDDYCWVTAHQLTRLLRHGYYVNVEARSLLACLQSW
selected fasta
>putative NDP-hexose 2,3-dehydratase
GTGGTGAGCCTCCCGGCAGGCCAGGTCGGCGGCCTCGCACGAGCACGAGCCCTCCCCTCG
GAGGCGTACCTGTCGGACGTCGCCGGTGCGGAGTTCATCGACTGGTTCGCCCGGTGCTCC
GCCGCCGCGCAGTGCCGGGTGACGCGGGCGCCGCTGACCGAGCTGCGGCGATGGCGGTTC
GACGCCGACACGGGAAACCTCGCGCACGAGTCCGGAGCCTTCTTCGCCGTCGAGGGCCTG
CGGGTGCGCACCAGTTACGGGCCGGTCCCCGAGTGGAGCCAGCCCATCATCAACCAGCCG
GAGATCGGCATCCTCGGCATGCTGGTCAAGGAGGTCGACGGCGTTCCGCACTGCCTCGTG
CAGGCCAAGATCGAGCCCGGCAACCACAACCGCATCCAGCTGTCGCCGACCGTCCAGGCC
ACCCGCAGCAACTACACCCGCATCCACCAGGGCCGCAGCACCCGTTATCTGGAGTTCTTC
ACCAAGGCCGGCGCGGGCCGCACCCTGGTGGACGTCCTGCAGTCCGAGCAGGGCGCGTGG
TTTCTGCGCAAGCGCAACCGCAACATGGTCGTCCAGGTGGCTGAGGACGTGCCCGCCGCC
AAGGGCTACCACTGGCTGCCGCTGACCGAACTGCGGCGGCTGCTGCGCATCGACGGCCTG
GTCAACATGGACACCCGGACCGTGCTGGCCTGCCTCCCGGCGGATACGTTCCCCGCCTCC
CGGCCGGTGCCGGTCGGTGACGTCGGGGCGGCACTCGTGCTGTCGTCGACGGGCCAGGGC
ACCTCCCTGAACGACATGGGGGCCGTGCTGCGCTGGTTCACCGAGGCCAAGAGCCGGCAC
CAACTGACGGCACACCGGACGCCCCTGCGGGACCTGCCCGGGTGGCGCGGCACTCCGGAG
CAGATCACCCACGAGGACGGGCGGCACTTCAGCATCATCGGGGTGACCGCCCAGGTCGGT
GACCGCGAGGTGGCCGAATGGGACCAGCCGCTGCTGTTCCCGCAGGGGCGCGGAGTCGTC
GCGTTCGTGATCAAGGTCATCGAAGGGGTCGCGCACCTGCTCGTCCACGCCCGGTTCCAG
CCCGGCCTGCTGGACGGCATGGAGATGGGCCCGACCGTGCAGTGCGTCCCGGAGAACTAT
CCGCAAGGGCCGCCGCGGTTCCTCGACTACGTCCTGACCGCTTCCCCGGAGCGCCTCCTC
TACAGTGCCGTCCTGGCCGAGGAGGGCGGGCGCTTCTACCACTCGCAGAACAGCTATCTC
CTGGTCGAGGCCGACGACGACTTCCCCGTAGCCGTCCCCGATGACTACTGCTGGGTGACC
GCCCACCAGCTCACCCGGCTCCTGCGGCACGGCTACTACGTCAACGTCGAGGCCCGGAGC
CTGCTCGCCTGCCTGCAGAGTTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [30-232]  4.3e-81 PF03559 [266-465]  1.4e-75 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit