close all open/close all

CDS information : Avil_00490


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction48,961 / 49,971 / + [in whole cluster]
48,961 / 49,971 / + [in contig]
Location48961..49971 [in whole cluster]
48961..49971 [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)
GeneaviT
Gene (GenBank)
EC number
Keyword
  • D-olivose
  • 2-deoxy-D-evalose
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q194Q3
NITE
Mith_00220
PmId
[11254130] The mtmVUC genes of the mithramycin gene cluster in Streptomyces argillaceus are involved in the biosynthesis of the sugar moieties. (Mol Gen Genet. , 2001)
ACC
B3TMR8
PmId
[17985890] Elucidation of the kijanimicin gene cluster: insights into the biosynthesis of spirotetronate antibiotics and nitrosugars. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase
MKNERPVRLGILGCSDIARRRTLPAALKVPELTVTAVASRSEDNARAVAARFGGEAVVGY
EALLESPDVDAVYVSLPTGLHHDWIVRALRAGKHVLAEKPLTARYPDTVTAVRLADSRGL
TLMENLTFTQHSLHDAVREMLDEGGIGELRSLTSEFGFPPLPPGNVRYQPELAGGSLLDA
GVYPLAAASMFLGPDLDVVGATLRMGTEAKVDVAGDALLCAPDGRTAHVSFGFEHAYRCA
YTLWGSEGRIIVDRAFTPPPDFRPTVRLERADEVRERVLPADDQFAGTLACFVRAVTGGG
SAAHSADVIARARLVSQVQGRARLLGNGWSGGADGR
selected fasta
>putative NDP-hexose C-3 ketoreductase
ATGAAGAACGAGCGTCCCGTGCGGCTGGGCATTCTCGGCTGCTCCGACATCGCCCGACGC
CGTACCCTGCCGGCCGCGCTGAAGGTGCCGGAGCTGACGGTGACCGCCGTCGCCTCCCGG
AGCGAGGACAACGCCCGTGCGGTCGCCGCGCGGTTCGGCGGCGAGGCCGTCGTCGGCTAC
GAGGCGCTGCTGGAGAGCCCGGATGTCGACGCGGTCTACGTCTCCCTGCCCACCGGACTG
CACCACGACTGGATCGTGCGCGCCCTGCGCGCGGGAAAGCACGTGCTCGCGGAGAAGCCG
CTGACCGCCCGCTACCCGGACACCGTGACGGCGGTCCGCCTCGCGGACTCCCGCGGCCTG
ACGCTGATGGAGAACCTGACCTTCACCCAGCACTCGCTGCACGACGCCGTGCGCGAGATG
CTGGACGAGGGCGGCATCGGTGAACTGCGCTCCCTCACCAGCGAGTTCGGGTTCCCGCCA
CTGCCTCCCGGCAACGTCCGGTACCAGCCGGAGCTGGCCGGCGGCAGCCTGCTGGACGCG
GGCGTGTATCCGCTCGCCGCGGCGAGCATGTTCCTCGGGCCCGACCTCGATGTGGTCGGG
GCGACGCTGCGGATGGGAACCGAGGCGAAAGTCGACGTGGCGGGCGACGCGCTGCTGTGT
GCGCCCGACGGCCGCACGGCACACGTGTCCTTCGGCTTCGAGCACGCCTACCGCTGCGCG
TACACGCTGTGGGGGAGCGAGGGCCGGATCATCGTCGACCGTGCCTTCACCCCGCCGCCC
GACTTCCGCCCCACGGTTCGGCTGGAACGCGCCGACGAGGTGCGCGAGCGCGTCCTGCCG
GCCGACGACCAGTTCGCCGGCACCCTCGCGTGCTTCGTCCGGGCCGTCACCGGCGGCGGG
TCGGCGGCGCACAGCGCCGATGTCATCGCACGGGCCCGATTGGTAAGTCAGGTGCAGGGC
CGGGCACGGCTGCTCGGCAACGGCTGGTCAGGAGGAGCAGATGGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [7-124]  3.4e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [138-242]  8.2e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [2-148]  1.9e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit