close all open/close all

CDS information : Avil_00500


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction49,961 / 50,938 / + [in whole cluster]
49,961 / 50,938 / + [in contig]
Location49961..50938 [in whole cluster]
49961..50938 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)
GeneaviZ3
Gene (GenBank)
EC number
Keyword
  • D-olivose
  • 2-deoxy-D-evalose
Note
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase
MADERERVLVAGGTGFVGRQLCADLTAAGAEVAAIARRVPDFPLPGRLLVLDVTTASPGE
LADVIDSVRPHTVVNAIGSNWGIAERDMETNCAVPTRRLLDALRRTACRPYVVHLGSVLE
YGPTPPGEPTRTASPPRPTTAYGKAKLAASQAVLEAAAEGVVEAGVLRIANVAGPGTPAV
SLLGRVAGRLAEAVTRDMLPAVVELSQLRAHRDYVDVRDVSDAVLAATRARIPGLVVPIG
RGEAVPVRWLVDLLVEVSGVPAEVRELPAAATGAAGDDWIQVDPGPARELLGWTAVRSLH
ESVTGLWADTLRRQAIPQHAEPRPS
selected fasta
>putative NDP-hexose C-4 ketoreductase
ATGGCCGATGAGCGCGAGCGCGTTCTCGTGGCTGGTGGGACGGGGTTCGTGGGCCGTCAG
CTGTGCGCGGACCTGACCGCGGCCGGAGCCGAGGTGGCGGCGATCGCCCGGCGGGTACCG
GACTTCCCCCTGCCGGGCCGGCTCCTCGTCCTGGACGTCACCACCGCGTCGCCCGGGGAA
CTGGCCGACGTGATCGACTCCGTCCGCCCGCACACGGTGGTCAACGCCATCGGCAGCAAC
TGGGGGATCGCCGAACGGGACATGGAGACCAACTGCGCGGTGCCGACCCGCCGCCTGCTG
GACGCGCTGCGGCGGACCGCGTGCCGTCCCTACGTCGTCCACCTCGGCTCAGTGCTGGAG
TACGGCCCGACCCCGCCCGGTGAACCGACCCGGACCGCGTCGCCGCCCCGGCCGACGACC
GCCTACGGCAAGGCCAAACTCGCGGCGAGCCAGGCCGTGCTGGAGGCCGCCGCGGAGGGC
GTCGTGGAGGCGGGCGTGCTGCGGATCGCCAACGTGGCCGGGCCGGGCACCCCGGCGGTC
AGCCTGCTCGGCCGGGTGGCCGGGCGGCTCGCCGAGGCGGTCACCCGGGACATGCTCCCG
GCGGTCGTGGAGCTGTCCCAGTTGCGCGCCCACCGCGACTACGTCGACGTGCGCGACGTC
TCGGACGCGGTGCTGGCCGCCACCCGCGCCCGTATTCCGGGGCTGGTCGTCCCCATCGGA
CGCGGCGAGGCCGTGCCGGTGCGGTGGCTCGTCGATCTGCTCGTCGAGGTGAGCGGCGTG
CCCGCCGAGGTCCGGGAGCTTCCCGCCGCCGCCACGGGCGCGGCCGGGGACGACTGGATC
CAGGTCGACCCCGGGCCCGCCCGCGAACTCCTCGGCTGGACCGCCGTCCGCTCGCTGCAC
GAGTCGGTGACCGGGCTGTGGGCCGACACGCTGCGCAGGCAGGCAATCCCCCAGCACGCG
GAGCCGCGGCCGTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [8-231]  1e-33 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [6-215]  2e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit