close all open/close all

CDS information : Avil_00520


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction52,147 / 54,519 / + [in whole cluster]
52,147 / 54,519 / + [in contig]
Location52147..54519 [in whole cluster]
52147..54519 [in contig]
TypeCDS
Length2,373 bp (790 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GeneaviX14
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein
MRERGERGGGAMGRSEREAVARGGRLHEAAQAVVDDHARAVEAVRAALEPIHEQLARREL
EVIPVARLSDLTEGRLRLGEVEKGGFRTVGQVLDAGSYRLRQLRGVGQQTADQTVAAAQR
IAEAVRDSIAVHIDVDRPEPRTTALVVALHVLVEAGPEARRAVEAGGALTKKLGPLLAEA
GPAAGRLRMLFAGRAARGRALAAVAEIRALTEQADHDGVPPLLAQASVDLLRRPGSEVAA
LVDFELRSAEYYGLLAELSGRAPDPAAAEGFLPDEVAERVRTQALDDTHRRVSLRGYQAF
GTRFALAQRRTILGDEMGLGKTIQAIAALAHLAAEGQSHFMVVCPASVLINWTRETEKRS
VLRVTPLHGPDRQDAFADWKGRGGVAVTTFDALRGFPAPGGGEVGMLVVDEAHYVKNPRT
RRSMAVSEWAEHCDRVLFLTGTPMENRVEEFRSLVRILQPELAEAIDEHDGVAGSKAFRK
AVAPVYLRRNQQDVLTELPALQHTDEWEEPSTADEEAYREAVRAGNFMAMRRAAYARPER
SAKVHRLREIAEEAAENGLKVVVFSAFRDVLAVVREALTDAAGPGAEAGPQDEPGSEEGR
ATADARGPAVERAATPDTPGQEEIAAVRDTPAPTERTGPRRVPGPRAGRVFGPISGSVPP
ARRQQLVDDFAAAPGHAVLLAQIEAGGVGLNMQAASVVILCEPQLKPTVEHQAVARAHRM
GQVRSVRVHRLLCTEGVDERLVRMLENKSRLFDAYARRSAVAESTPDAVDISDLALARHI
VEEEQARLGA
selected fasta
>hypothetical protein
ATGCGGGAACGCGGTGAGAGGGGCGGGGGCGCGATGGGGCGGAGTGAGCGGGAGGCGGTG
GCCCGGGGCGGGCGGCTTCACGAGGCGGCGCAGGCGGTGGTCGACGATCACGCACGCGCC
GTCGAGGCCGTACGGGCGGCCCTGGAACCGATCCATGAGCAACTGGCCCGGCGCGAGCTG
GAGGTCATCCCGGTGGCCCGGCTGTCGGACCTCACCGAGGGCAGGCTGCGCCTGGGGGAG
GTGGAGAAGGGCGGGTTCCGGACGGTCGGCCAGGTGCTCGACGCCGGCTCGTACCGGCTG
CGCCAGCTCCGCGGGGTCGGGCAGCAGACCGCCGACCAGACGGTGGCCGCCGCCCAGCGG
ATCGCCGAGGCTGTACGGGACAGCATCGCCGTACACATCGACGTGGACAGGCCCGAGCCC
CGGACCACCGCACTGGTCGTCGCGCTGCACGTGCTGGTGGAGGCGGGCCCCGAGGCACGC
CGGGCCGTCGAGGCGGGCGGGGCGCTGACGAAGAAGCTCGGCCCGCTGCTGGCCGAGGCG
GGGCCGGCGGCAGGCCGGCTGCGCATGCTGTTCGCGGGGCGGGCCGCACGGGGACGGGCG
CTGGCGGCCGTGGCGGAGATCCGCGCACTGACCGAGCAGGCCGACCACGACGGTGTGCCA
CCGCTGCTCGCCCAGGCCTCGGTCGACCTGCTGCGCCGCCCGGGCTCCGAGGTGGCCGCC
CTGGTCGACTTCGAGCTGCGCTCCGCCGAGTACTACGGCCTGCTCGCCGAGCTCTCGGGC
CGCGCCCCCGACCCCGCGGCGGCCGAGGGGTTCCTGCCGGACGAGGTGGCCGAGCGGGTC
AGGACCCAGGCGCTCGACGACACGCACCGCCGGGTCTCACTGCGCGGCTACCAGGCCTTC
GGCACCCGCTTCGCCCTCGCCCAGCGCCGGACGATCCTCGGCGACGAGATGGGGCTCGGC
AAGACGATCCAGGCCATCGCCGCACTCGCGCACCTAGCCGCCGAGGGGCAGAGCCACTTC
ATGGTGGTCTGTCCGGCCAGCGTGCTGATCAACTGGACCCGGGAGACCGAGAAGCGCAGT
GTGCTGCGCGTGACACCGCTGCACGGCCCCGACCGGCAGGACGCGTTCGCCGACTGGAAG
GGGCGGGGCGGCGTCGCGGTCACCACCTTCGACGCGCTGCGGGGCTTCCCGGCGCCCGGG
GGCGGCGAGGTGGGCATGCTCGTCGTGGACGAGGCCCACTACGTGAAGAATCCCCGGACC
CGCCGCTCCATGGCCGTCTCCGAGTGGGCGGAGCACTGCGACCGCGTGCTGTTCCTGACC
GGTACGCCCATGGAGAACCGCGTCGAGGAGTTCCGCAGCCTGGTGCGGATCCTCCAGCCC
GAGCTGGCGGAGGCCATCGACGAGCACGACGGCGTGGCGGGCTCCAAGGCGTTCCGCAAG
GCGGTCGCACCGGTCTATCTGCGCCGCAACCAGCAGGACGTCCTCACCGAACTCCCGGCG
CTCCAGCACACGGACGAGTGGGAGGAGCCCAGCACGGCGGACGAGGAGGCCTACCGCGAG
GCCGTGCGCGCCGGCAACTTCATGGCGATGCGCAGGGCGGCGTACGCGCGTCCGGAGCGG
TCCGCGAAGGTGCACCGGCTGCGCGAGATCGCTGAGGAGGCCGCCGAGAACGGGCTGAAG
GTCGTGGTGTTCTCCGCGTTCCGGGACGTACTGGCAGTGGTACGCGAGGCGCTCACGGAC
GCGGCCGGGCCAGGGGCGGAAGCAGGCCCGCAGGACGAGCCGGGGTCCGAAGAGGGGCGA
GCCACAGCGGATGCGCGGGGCCCGGCGGTGGAAAGGGCAGCCACGCCGGACACGCCGGGC
CAGGAGGAGATCGCCGCCGTACGGGACACACCGGCGCCGACGGAGCGGACGGGGCCGCGC
AGGGTGCCGGGACCGCGGGCCGGGCGTGTGTTCGGGCCGATCTCGGGCAGCGTGCCGCCC
GCCCGCCGACAGCAGCTCGTCGACGACTTCGCCGCCGCGCCCGGTCACGCCGTACTGCTC
GCGCAGATCGAGGCAGGCGGAGTGGGCCTCAACATGCAGGCCGCCTCCGTGGTGATCCTC
TGCGAGCCGCAGCTCAAGCCGACCGTCGAACACCAGGCGGTCGCCCGTGCCCACCGCATG
GGCCAGGTCCGCTCGGTCCGCGTGCACCGCCTGCTCTGCACGGAAGGGGTGGACGAACGC
CTGGTGCGGATGCTGGAGAACAAGTCCCGCCTGTTCGACGCTTACGCCCGCCGCAGCGCG
GTCGCCGAGTCGACACCGGACGCCGTCGACATCTCGGACCTCGCCCTGGCCCGCCACATC
GTGGAGGAGGAACAGGCACGGTTGGGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000330 SNF2-related (Domain)
 [308-539]  1.1e-35 PF00176
PF00176   SNF2_N
IPR001650 Helicase, C-terminal (Domain)
 [602-773]  8.98 PS51194
PS51194   HELICASE_CTER
 [632-721]  7.6e-06 SM00490
SM00490   helicase superfamily c-terminal domain
 [652-721]  3.4e-06 PF00271
PF00271   Helicase_C
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [302-461]  17.293 PS51192
PS51192   HELICASE_ATP_BIND_1
 [290-469]  1.4e-22 SM00487
SM00487   DEAD-like helicases superfamily
SignalP No significant hit
TMHMM No significant hit