close all open/close all

CDS information : Avil_00530


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction55,545 / 54,718 / - [in whole cluster]
55,545 / 54,718 / - [in contig]
Locationcomplement(54718..55545) [in whole cluster]
complement(54718..55545) [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative DNA-binding protein
Product (GenBank)
GeneaviX15
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q9FDT3
PmId
[15849419] DNA-binding protein involved in the regulation of chitinase production in Streptomyces lividans. (Biosci Biotechnol Biochem. , 2005)
Family/Domain
FD
IPR001387

close this sectionSequence

selected fasta
>putative DNA-binding protein
MNSKKLPRKKNLSTMRMVGKQMQAARKAAGFTQSSLGKAVLADEETIASIEQGRRPLLLE
LAQALDELLDTKGTLAAGVENMPEIDQFPLFAEQYMVHEREAISLCWYDNAVLPGLLQTR
DYARAVLRERVPPYDEDELEAKTEGRIERQEILHRKCPPMMSFIVWEPVLYIELGGPKVH
RDQLRHLRECAELPGLALQFLPMRTSAHAGLDGPFTLLETPDHQHLAYTESQRGSQWVSG
PDEVSILARKYAMLRSQAMTPQESKSLLDRLVGDK
selected fasta
>putative DNA-binding protein
ATGAACTCCAAGAAGCTGCCGCGGAAGAAGAACCTGTCGACCATGCGGATGGTGGGCAAG
CAGATGCAGGCCGCCCGCAAGGCGGCGGGCTTCACGCAGAGTTCCCTGGGCAAAGCGGTC
CTCGCCGACGAGGAGACCATCGCGTCGATCGAACAGGGGAGGCGGCCCCTGCTGCTCGAA
CTCGCCCAGGCGCTGGACGAACTCCTCGACACGAAGGGCACGTTGGCTGCCGGGGTCGAG
AACATGCCGGAGATCGACCAGTTCCCGCTGTTCGCGGAGCAGTACATGGTGCACGAGCGG
GAGGCCATCTCCCTGTGCTGGTACGACAACGCCGTCCTGCCCGGCCTGCTCCAGACCCGC
GACTACGCCCGCGCGGTCCTGCGCGAGCGCGTACCGCCGTACGACGAGGACGAGCTGGAA
GCCAAGACGGAGGGTCGCATCGAACGCCAGGAGATCCTGCACCGCAAGTGCCCGCCGATG
ATGAGCTTCATCGTGTGGGAGCCGGTGCTGTACATCGAACTCGGGGGGCCGAAAGTCCAC
CGCGACCAGCTCCGCCACCTACGCGAGTGCGCCGAACTCCCGGGGCTCGCCCTCCAGTTT
CTACCCATGCGCACCTCCGCACACGCCGGACTGGACGGCCCCTTCACCCTCCTGGAGACG
CCCGATCACCAGCACCTGGCCTACACCGAGAGCCAACGTGGCAGCCAGTGGGTTTCTGGC
CCGGACGAGGTGTCCATCCTGGCGCGCAAGTATGCGATGCTGCGGTCACAGGCCATGACT
CCGCAGGAGTCGAAGAGCCTGCTAGACCGTCTGGTGGGAGATAAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001387 Helix-turn-helix type 3 (Domain)
 [22-72]  9.677 PS50943
PS50943   HTH_CROC1
 [21-76]  0.003 SM00530
SM00530   Helix-turn-helix XRE-family like proteins
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [5-70]  2.9e-06 G3DSA:1.10.260.40
G3DSA:1.10.260.40   no description
 [12-89]  1.2e-07 SSF47413
SSF47413   lambda repressor-like DNA-binding domains
SignalP No significant hit
TMHMM No significant hit