close all open/close all
Avil_00530 Avil_00530   last last

CDS information : Avil_00540


close this sectionLocation

Organism
StrainTü57
Entry nameAvilamycin
Contig
Start / Stop / Direction56,192 / 57,757 / + [in whole cluster]
56,192 / 57,757 / + [in contig]
Location56192..57757 [in whole cluster]
56192..57757 [in contig]
TypeCDS
Length1,566 bp (521 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S8 family peptidase
Product (GenBank)
GeneaviX16
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in avilamycin biosynthesis.
Note (GenBank)
Reference
PmId
[11410376] Biosynthesis of the orthosomycin antibiotic avilamycin A: deductions from the molecular analysis of the avi biosynthetic gene cluster of Streptomyces viridochromogenes Tu57 and production of new antibiotics. (Chem Biol. , 2001)
Related Reference
ACC
Q53401
PmId
[8294010] Cloning and sequence of an alkaline serine protease-encoding gene from the marine bacterium Alteromonas sp. strain O-7. (Gene. , 1993)
[10966390] A serine protease-encoding gene (aprII) of Alteromonas sp. Strain O-7 is regulated by the iron uptake regulator (Fur) protein. (Appl Environ Microbiol. , 2000)

close this sectionSequence

selected fasta
>putative S8 family peptidase
MAVMRHTRRRLAALSVTATAALAASLVSALPATAAPEGRIQYAGAADAVADSYIVNLKAD
HARSGSEAGRALVEKYGADIERTYKKALNGYAIEASEAEAKALAADPAVASVVQNRMFSI
DATQTNPPSWGLDRVDQKNLPLNSSYTYPDSAGQGVTAYVIDTGVRITHSDFGGRASYGY
DAIDNDNTAQDGHGHGTHVAGTVAGNAYGVAKKAKIVGVRVLNNSGQGTTAQVVAGIDWV
ARNAVKPAVANMSLGGGADTALDTAVRNAMASGVTFAVAAGNESTNASTRSPARVTEAIT
VGATTSSDAKAGYSNYGSVLDLFAPGSSITSAWNSSDSATNTISGTSMATPHVAGAAALH
LAANPSATPSQVATALTSAATTGVVTNPGTGSPNRLLYVGRRHDHPPGPRFENTGDYTIS
DNSTVESPVTVSGVSGNAPSALAVEVHIVHTYIGDLQVQLIAPDGTAYTLKSYGTGGSSD
NINTTYSVNASSEAANGTWKLRVSDNANYDTGRIDAWALQF
selected fasta
>putative S8 family peptidase
ATGGCAGTGATGCGTCATACCCGGCGAAGACTGGCCGCCCTCAGCGTGACGGCCACCGCG
GCCCTCGCCGCGAGCCTCGTCTCCGCTCTCCCCGCCACGGCCGCCCCCGAGGGCCGTATC
CAGTACGCGGGCGCGGCAGACGCCGTGGCCGACAGCTACATCGTGAACCTCAAGGCGGAC
CACGCCCGTTCGGGTTCCGAGGCCGGACGCGCCCTCGTCGAGAAGTACGGCGCCGACATC
GAGCGCACGTACAAGAAGGCCCTGAACGGCTACGCGATCGAGGCCTCCGAGGCGGAGGCC
AAGGCGCTCGCCGCCGACCCGGCGGTCGCCTCCGTGGTCCAGAACCGCATGTTCAGCATC
GACGCGACCCAGACCAACCCGCCCTCCTGGGGCCTGGACCGCGTGGACCAGAAGAACCTC
CCCCTGAACAGCTCGTACACCTACCCGGACTCGGCCGGGCAGGGAGTGACGGCGTACGTC
ATCGACACCGGCGTCCGCATCACCCACAGCGACTTCGGCGGCCGGGCCTCCTACGGCTAC
GACGCCATCGACAACGACAACACCGCCCAGGACGGCCACGGCCACGGCACGCACGTGGCC
GGCACGGTCGCCGGCAACGCCTACGGCGTCGCCAAGAAGGCCAAGATCGTAGGCGTCCGC
GTGCTGAACAACTCCGGCCAGGGCACCACCGCCCAGGTCGTCGCCGGCATCGACTGGGTC
GCCCGGAACGCCGTCAAGCCGGCCGTCGCCAACATGTCCCTCGGCGGCGGCGCCGACACG
GCCCTCGACACGGCCGTACGCAACGCCATGGCCTCCGGCGTCACCTTCGCCGTGGCGGCC
GGCAACGAGTCGACCAACGCCTCCACGAGGTCACCCGCACGCGTCACCGAGGCCATCACG
GTCGGCGCGACGACCAGCTCGGACGCCAAGGCCGGCTACTCCAACTACGGCTCCGTCCTC
GACCTCTTCGCCCCCGGTTCGTCCATCACCTCGGCCTGGAACTCAAGCGACTCGGCGACC
AACACCATCTCCGGTACGTCGATGGCGACCCCGCACGTGGCGGGCGCCGCCGCGCTCCAC
CTCGCCGCCAACCCCTCGGCCACCCCGTCCCAGGTCGCCACGGCGCTGACGTCCGCCGCC
ACCACCGGCGTCGTCACCAACCCCGGCACGGGCTCGCCCAACCGGCTCCTGTACGTCGGC
CGGCGGCACGACCACCCTCCGGGCCCGCGCTTCGAGAACACCGGTGACTACACGATCAGC
GACAACTCCACGGTCGAGTCCCCGGTGACGGTCTCCGGCGTCTCCGGCAACGCGCCCTCG
GCCCTCGCCGTAGAGGTCCACATCGTCCACACGTACATCGGCGACCTCCAGGTCCAGCTG
ATCGCCCCCGACGGCACGGCGTACACGCTCAAGTCGTACGGCACCGGCGGCAGTTCGGAC
AACATCAACACCACGTACTCGGTGAACGCCTCCTCGGAGGCGGCCAACGGCACGTGGAAA
CTGCGGGTGAGCGACAACGCGAACTACGACACCGGGCGCATAGACGCCTGGGCGCTGCAG
TTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000209 Peptidase S8/S53, subtilisin/kexin/sedolisin (Domain)
 [103-398]  1.3e-76 SSF52743
SSF52743   Subtilisin-like
 [159-384]  3.9e-59 PF00082
PF00082   Peptidase_S8
 [128-394]  4.6e-84 G3DSA:3.40.50.200
G3DSA:3.40.50.200   no description
IPR002884 Proprotein convertase, P (Domain)
 [442-521]  1.5e-17 PF01483
PF01483   P_proprotein
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-34]  7.878 PS51318
PS51318   TAT
IPR008979 Galactose-binding domain-like (Domain)
 [398-521]  3.4e-24 SSF49785
SSF49785   Galactose-binding domain-like
IPR009020 Proteinase inhibitor, propeptide (Domain)
 [50-120]  1e-11 SSF54897
SSF54897   Protease propeptides/inhibitors
IPR010259 Proteinase inhibitor I9 (Domain)
 [52-120]  1.1e-10 PF05922
PF05922   Inhibitor_I9
IPR015500 Peptidase S8, subtilisin-related (Family)
 [153-172]  6.8e-20 PR00723 [191-204]  6.8e-20 PR00723 [344-360]  6.8e-20 PR00723
PR00723   SUBTILISIN
IPR022398 Peptidase S8, subtilisin, His-active site (Active_site)
 [195-205]  PS00137
PS00137   SUBTILASE_HIS
IPR023827 Peptidase S8, subtilisin, Asp-active site (Active_site)
 [158-169]  PS00136
PS00136   SUBTILASE_ASP
IPR023828 Peptidase S8, subtilisin, Ser-active site (Active_site)
 [345-355]  PS00138
PS00138   SUBTILASE_SER
SignalP
 [1-29]  0.664 Signal
Eukaryota   
 [1-34]  0.712 Signal
Bacteria, Gram-positive   
 [1-34]  0.81 Signal
Bacteria, Gram-negative   
TMHMM
 [13-35]  Transmembrane (i-o)
Transmembrane 1   
Avil_00530 Avil_00530   last last