close all open/close all
first first   Azino_00020 Azino_00020

CDS information : Azino_00010


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction3 / 425 / + [in whole cluster]
3 / 425 / + [in contig]
Location3..425 [in whole cluster]
3..425 [in contig]
TypeCDS
Length423 bp (140 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)Azi0
Geneorf(-1)
Gene (GenBank)azi0
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • stage II sporulation protein E
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [Azi0]
MLADLDMETGRLTWVNRGDHLPILIRDSRWITDLSCPPAGPMGADLGLSVTVATEQLEPG
DRLLLYTDGIVEARDRHGTEFGRDRFVDFIRRHHSGRHTLHETLRRLMAAVMEHHDGKLD
DDATVLLTEWRGGHQRELTP
selected fasta
>hypothetical protein(fragment) [Azi0]
ATCCTGGCCGACCTGGACATGGAGACCGGCAGGCTGACGTGGGTCAACCGCGGCGACCAT
CTGCCGATCCTGATCCGTGACAGCCGCTGGATCACCGACCTGTCCTGTCCCCCGGCCGGT
CCCATGGGAGCCGACCTGGGCCTGTCCGTCACCGTGGCCACCGAGCAGCTGGAGCCCGGT
GACCGACTGCTGCTGTACACGGACGGCATCGTCGAAGCCCGCGACAGACACGGAACGGAG
TTCGGACGGGACCGTTTCGTCGACTTCATCCGCCGCCATCACTCCGGCCGGCACACCCTG
CACGAGACCCTGCGCCGGCTGATGGCCGCCGTCATGGAACACCACGACGGCAAGCTCGAC
GACGACGCCACGGTCCTGCTCACCGAATGGCGCGGCGGCCACCAGCGCGAGCTGACCCCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001932 Protein phosphatase 2C-like (Domain)
 [45-127]  7e-05 G3DSA:3.60.40.10
G3DSA:3.60.40.10   no description
 [9-132]  1.3e-07 SSF81606
SSF81606   PP2C-like
 [2-130]  8.2e-28 PF07228
PF07228   SpoIIE
SignalP No significant hit
TMHMM No significant hit
first first   Azino_00020 Azino_00020