close all open/close all

CDS information : Azino_00020


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction6,387 / 2,596 / - [in whole cluster]
6,387 / 2,596 / - [in contig]
Locationcomplement(2596..6387) [in whole cluster]
complement(2596..6387) [in contig]
TypeCDS
Length3,792 bp (1,263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)Azi1
GeneaziA3
Gene (GenBank)azi1
EC number
Keyword
Note
Note (GenBank)
  • AMP-dependent synthetase and ligase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

B3 alpha-ketoisovaleric acid
A115..556
KR871..1060
PCP1195..1262

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [Azi1]
MTTATSAAVPQLSLETVAEIAAGTAGVRDAAAVRDRRLRVTATRRAASGPGSGGGEAGRG
TAVPADRPALVRGPEPVLPPDAVPTLPQALARAARVAPGRGTTYLLPDGSTDRQTYAELY
EDARRMLGGLRRHGLAPGDPVLLQCADSRTFVTAWWACVLGGFLPTPLAPAPEYATDNAA
VRKLAAAWDLLGRPPVIADPGLCEGVRSLAGRLPGGEAPRVLASDALPDPEPADWTVPDP
DALIVNLLTSGSTGTPKCVQHRHRTIVARSYAAIAANGFTEHDVSLNWMPLDHVGGMIMY
NLRDVFLACEHVNVRTESVIRRPLLWLDCLDRFRATNTWAPNFAFSLVCQRAEEIAAGSW
DLSRLTNICNAGEAVVARTALRFVELLAPHALPADAMVPCWGMSETSSGVTYTRMHRDDA
AVGTVSLVPASLDGELRELPAGTPGAVVVTEVGSPVPGVALRIVDQEGEVLPEGRVGRLH
VSGDTVLSGYAYNERANRESFTADGWFDTGDLGFLRDGRLFLTGRRKNMVIVNGANFPAH
EIEAVVEQVPGVVPACSAVAGVPDEDTGTDALVVFFVPGTDDVPALVDAIRSALARDLAL
RPTYVVPVTSREFPRHNGGKVQRERLLEGWREGLFDDRCYGGGTDGVAPDEAPDSEASVP
ALAVVWEPADARLRQRPDGPLVACVSGDVPDWLPVSTTAQIVVGPDAVELASALERAFAT
AGEGPTDEGAVPQVLFVAASDPATAPADGDAGVLSEFLAVASAVARIRPDAELTVLTRGA
VPAAPGDTVVPGRTGLTALVRTARSERLLARTALIDAPADAGAAELAALATVRHSGDVIA
VRDGRPLQQRLRAVPLPEVFDVPADVLPRGGTCLITGGLGGLGRAVAEHLVVTHGARLLI
VGRTPQERLDTGAREALEVLHAIGEVRYRTADAADPDALAGAVAEAEASWGCGLDLVLHL
AGAAVAPQWESLTDHELRAESAQWLATMLHPKAGGCAALDGVLATRPDTAVVLYSSVNGL
FGGTGFGAYAAANAVLDGWAQRWAAAGRRAQSLAWSMWDGPGMNQGSPLVAAGRHRGLTL
IDPTRGTLALLGALHAGPVHLLIGADPANEQIKPLLAADQLGGGTVAVAVVPASDTDPQQ
VRAAVSAQLADRGIFARVVVTSRIERDRSGTPDPAAVLAAVGAGGASYLPPEGRLEALLA
EAAAEVLGVARVGRDDSFFSLGCDSIRAVQLAEALSGQLDSPVSVGSLYESPTVRSLAAR
IAG
selected fasta
>non-ribosomal peptide synthetase [Azi1]
GTGACCACCGCCACCAGCGCCGCAGTCCCCCAGCTCTCCCTGGAGACCGTCGCCGAGATC
GCGGCCGGTACCGCCGGGGTCCGTGACGCCGCCGCCGTCCGCGACCGCCGGCTGCGCGTC
ACCGCCACGCGCCGCGCGGCGTCCGGTCCCGGGTCCGGCGGAGGCGAAGCGGGGCGCGGC
ACCGCCGTCCCCGCCGACCGTCCGGCCCTGGTTCGCGGCCCCGAGCCGGTGCTGCCGCCG
GACGCCGTGCCGACGCTGCCGCAGGCGCTGGCCCGGGCGGCGCGGGTGGCTCCGGGCCGC
GGCACCACCTATCTGCTGCCGGACGGCAGCACCGACCGGCAGACGTACGCCGAGCTGTAC
GAGGACGCCCGCCGCATGCTGGGCGGACTGCGCCGCCACGGTCTGGCCCCGGGCGACCCC
GTGCTGCTGCAGTGCGCCGACAGCCGTACGTTCGTCACCGCCTGGTGGGCCTGTGTGCTG
GGCGGGTTCCTGCCCACTCCGCTGGCTCCGGCGCCGGAGTACGCCACGGACAACGCCGCG
GTACGCAAGCTCGCCGCCGCCTGGGACCTGCTCGGCCGGCCGCCGGTGATCGCCGATCCC
GGGCTGTGCGAAGGGGTGCGTTCGCTGGCCGGCCGACTGCCTGGCGGCGAGGCGCCGCGG
GTACTGGCCTCCGACGCCCTGCCCGATCCGGAACCGGCCGACTGGACCGTACCGGACCCG
GACGCGCTGATCGTCAACCTGCTCACCTCCGGCAGCACCGGCACGCCCAAGTGCGTGCAG
CACCGCCATCGCACGATCGTCGCCAGGAGCTACGCGGCGATCGCCGCGAACGGCTTCACG
GAGCACGACGTCTCGCTCAACTGGATGCCGCTGGACCACGTCGGCGGCATGATCATGTAC
AACCTCCGGGACGTGTTCCTGGCGTGTGAGCACGTCAACGTACGAACGGAGTCGGTGATC
CGCAGGCCGTTGCTGTGGCTGGACTGTCTGGACCGGTTCCGTGCCACCAACACCTGGGCG
CCCAACTTCGCGTTCTCGCTCGTGTGCCAGCGCGCGGAGGAGATCGCCGCCGGTTCCTGG
GACCTCAGCCGTCTGACCAACATCTGCAACGCCGGTGAGGCCGTCGTCGCCCGTACCGCA
CTCCGCTTCGTGGAACTGCTCGCCCCGCACGCACTGCCCGCCGACGCCATGGTGCCCTGC
TGGGGGATGTCGGAGACGTCCTCGGGGGTCACGTACACCCGCATGCACCGTGACGACGCG
GCGGTCGGCACCGTCTCCCTGGTGCCCGCCTCGCTGGACGGCGAACTGCGCGAGCTGCCG
GCGGGCACTCCCGGCGCGGTCGTGGTGACCGAGGTCGGTTCCCCGGTGCCCGGTGTCGCC
CTGCGCATCGTGGACCAGGAAGGAGAGGTGCTCCCGGAGGGCCGGGTCGGGCGGCTGCAC
GTGTCCGGCGACACGGTCCTGAGCGGTTACGCGTACAACGAGCGGGCCAACCGGGAGAGT
TTCACCGCGGACGGCTGGTTCGACACGGGTGACCTGGGGTTCCTGCGTGACGGCCGGCTG
TTCCTCACCGGCCGCCGGAAGAACATGGTGATCGTCAACGGGGCGAACTTCCCCGCGCAC
GAGATCGAGGCGGTGGTGGAGCAGGTACCCGGCGTCGTGCCCGCCTGCTCCGCGGTGGCC
GGGGTGCCCGACGAGGACACCGGCACCGACGCTCTGGTGGTCTTCTTCGTGCCCGGCACC
GACGACGTGCCCGCGCTGGTGGACGCCATCCGCTCGGCTCTCGCCCGCGACCTGGCCCTG
CGTCCGACCTACGTGGTGCCGGTGACGTCCCGGGAGTTCCCACGGCACAACGGCGGGAAG
GTGCAGCGCGAGCGGCTGCTCGAAGGCTGGCGCGAAGGCCTGTTCGACGACCGCTGTTAC
GGCGGTGGGACGGACGGCGTCGCACCGGACGAGGCGCCGGACTCGGAGGCCTCCGTCCCC
GCGCTGGCGGTCGTGTGGGAACCGGCCGACGCACGGCTGAGGCAACGGCCGGACGGTCCC
CTCGTGGCCTGTGTCAGCGGTGACGTCCCCGACTGGCTGCCCGTGTCGACCACGGCTCAG
ATCGTGGTCGGCCCGGACGCCGTGGAGCTGGCCTCGGCCCTGGAGCGGGCCTTCGCGACG
GCCGGCGAGGGGCCCACGGACGAAGGGGCCGTACCACAGGTGCTGTTCGTCGCCGCCTCG
GACCCCGCGACGGCGCCGGCCGACGGCGACGCCGGGGTGCTGTCGGAGTTCCTCGCCGTG
GCGTCGGCCGTGGCGCGGATCCGCCCCGATGCCGAGCTCACCGTGCTGACCCGGGGAGCC
GTGCCGGCCGCCCCGGGCGACACGGTTGTTCCGGGCCGGACCGGACTGACCGCGCTGGTG
CGTACCGCGCGCTCGGAACGGCTTCTCGCCCGTACCGCACTGATCGACGCCCCGGCGGAC
GCCGGCGCGGCCGAGCTCGCGGCCCTGGCCACGGTGCGGCACAGCGGCGACGTGATCGCC
GTGCGTGACGGCAGGCCGCTGCAACAGCGGCTGCGCGCCGTGCCGTTGCCGGAGGTCTTC
GACGTACCCGCTGATGTGCTGCCCCGGGGCGGGACCTGCCTCATCACCGGTGGTCTCGGC
GGCCTGGGACGAGCCGTGGCGGAGCACCTGGTGGTCACGCACGGGGCACGGCTGCTGATC
GTCGGGCGGACCCCGCAGGAGCGCCTGGACACCGGGGCCCGGGAGGCGCTGGAGGTCCTG
CACGCCATCGGCGAGGTCCGCTACCGCACGGCCGATGCCGCGGACCCGGACGCGCTGGCC
GGGGCGGTGGCCGAAGCGGAGGCGTCCTGGGGGTGCGGCCTCGACCTGGTGCTGCATCTC
GCCGGTGCCGCGGTCGCCCCGCAGTGGGAGTCCTTGACCGACCACGAACTGCGGGCCGAG
TCCGCGCAGTGGCTCGCGACGATGCTGCATCCGAAGGCCGGTGGCTGTGCGGCCCTCGAT
GGGGTGCTGGCCACACGGCCGGACACCGCCGTGGTGCTGTACTCGTCCGTGAACGGTCTG
TTCGGCGGGACGGGTTTCGGTGCGTACGCGGCGGCCAACGCGGTACTGGACGGCTGGGCC
CAGCGCTGGGCCGCGGCGGGGCGACGGGCCCAGAGCCTGGCCTGGAGCATGTGGGACGGC
CCGGGGATGAACCAGGGCAGTCCGCTGGTCGCGGCGGGCAGGCACCGGGGACTGACCCTG
ATCGACCCGACCCGGGGCACGCTGGCCCTGCTGGGCGCCCTGCACGCCGGGCCGGTACAC
CTGCTCATCGGCGCGGATCCGGCGAACGAGCAGATCAAGCCGCTCCTGGCGGCGGACCAA
TTGGGCGGCGGCACCGTCGCCGTGGCGGTCGTACCCGCGTCGGACACGGACCCTCAGCAG
GTGCGGGCCGCGGTGTCGGCTCAACTGGCCGACCGTGGGATCTTCGCCCGGGTCGTGGTG
ACCTCACGGATAGAGCGGGACCGCAGTGGCACCCCCGACCCGGCCGCTGTACTCGCGGCC
GTCGGCGCGGGCGGCGCCTCCTATCTGCCGCCCGAAGGACGGCTCGAAGCACTGTTGGCC
GAGGCCGCGGCCGAGGTGCTCGGAGTCGCGCGCGTGGGCAGGGACGACTCGTTCTTCAGC
CTGGGGTGCGATTCGATCAGGGCTGTGCAGCTTGCGGAGGCGCTGAGCGGGCAGCTGGAC
AGTCCGGTCTCGGTGGGCTCGCTCTACGAGTCCCCGACGGTCCGCTCCCTGGCGGCCAGG
ATCGCCGGCTGA
[3] A115..556
[3] alpha-ketoisovaleric acid296..409
[3] KR871..1060
[3] PCP1195..1262
[3] A343..1668
[3] alpha-ketoisovaleric acid886..1227
[3] KR2611..3180
[3] PCP3583..3786

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [115-556]  4.2e-77 PF00501
PF00501   AMP-binding
IPR009081 Acyl carrier protein-like (Domain)
 [1188-1263]  1.10000150671642e-17 SSF47336
SSF47336   ACP_like
 [1199-1261]  8.60000000000001e-12 PF00550
PF00550   PP-binding
 [1186-1262]  1.69999999999999e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1195-1262]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [871-1060]  1.6e-33 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [869-1067]  6.40000000000001e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit